Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CT9 p20 gene, complete cds.

ACC No: GQ338642

Dated: 2012-01-02 | Length: 549 | CRC: 581549768

                
ID   GQ338642; SV 1; linear; genomic RNA; STD; VRL; 549 BP.
XX
AC   GQ338642;
XX
DT   02-JAN-2012 (Rel. 111, Created)
DT   02-JAN-2012 (Rel. 111, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CT9 p20 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-549
RA   Yi L., Zhou C.Y., Zhou Y.;
RT   "Origin and evolution of viruses causing Citrus tristeza disease";
RL   Unpublished.
XX
RN   [2]
RP   1-549
RA   Yi L., Zhou C.Y., Zhou Y.;
RT   ;
RL   Submitted (30-JUN-2009) to the INSDC.
RL   Citrus Research Institute, Chinese Academy of Agricultural Science, Xiema,
RL   Beibei, Chongqing 400712, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .549
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus paradisi"
FT                   /isolate="CT9"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .549
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="ADH95354.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQEGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSAVD
FT                   VMGFFVMRYMSSSHTSFESVMRTELKLVVKVVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVSTVCGQFDINLVSPSCV"
XX
SQ   Sequence 549 BP; 132 A; 105 C; 146 G; 166 T; 0 other;

gq338642 Length: 549  02-JAN-2012  Type: N  Check: 8821  ..

       1  atgcgagctt actttagtgt taacgattac ataagccttt tggctaaagt
      51  cggcgcggtt gtggaacgtt tgtgcgatcc cagcgtaact cttacggaag
     101  tgatggacga gattaatgac tttaactcgt ttctcgcttt ggtgcactct
     151  atgaaatcag acatgaacgg agaccatcag gaaggccacc atgagatggg
     201  tgaacataag tctcgattgt tatgcaatat agaggcgaaa ttgcgagtac
     251  ttctcgacat tataaggcgt cggttcactc gcgaaaagct gctttgtacc
     301  agtgcggtag atgtcatggg ctttttcgtt atgaggtaca tgagctccag
     351  ccacactagc ttcgagtctg taatgagaac agagttgaag ttagtagtta
     401  aggtggtact gtcggatctg tcccgtgcgc ataagttgga ttttagcgag
     451  cgagcttttg ctgcttacgg tatccttttg caaaagggta ctgtgtcgac
     501  cgtttgcggt cagtttgaca ttaatttagt gtctccatct tgcgtgtag