Sequence of DPV Drosophila melanogaster American nodavirus

Drosophila melanogaster American nodavirus (ANV) SW-2009a segment RNA2, complete sequence.

ACC No: GQ342966

Dated: 2010-02-05 | Length: 1416 | CRC: -1636489248

                
ID   GQ342966; SV 1; linear; genomic RNA; STD; VRL; 1416 BP.
XX
AC   GQ342966;
XX
DT   09-NOV-2009 (Rel. 102, Created)
DT   05-FEB-2010 (Rel. 103, Last updated, Version 2)
XX
DE   Drosophila melanogaster American nodavirus (ANV) SW-2009a segment RNA2,
DE   complete sequence.
XX
KW   .
XX
OS   Drosophila melanogaster American nodavirus (ANV) SW-2009a
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Nodaviridae;
OC   unclassified Nodaviridae.
XX
RN   [1]
RP   1-1416
RX   PUBMED; 20080648.
RA   Wu Q., Luo Y., Lu R., Lau N., Lai E.C., Li W.X., Ding S.W.;
RT   "Virus discovery by deep sequencing and assembly of virus-derived small
RT   silencing RNAs";
RL   Proc. Natl. Acad. Sci. U.S.A. 107(4):1606-1611(2010).
XX
RN   [2]
RP   1-1416
RA   Wu Q., Ding S.-W.;
RT   ;
RL   Submitted (29-JUN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology & Microbiology, UC Riverside, 900 University Ave,
RL   Riverside, CA 92521, USA
XX
CC   GenBank Accession Numbers GQ342965-GQ342966 represent the complete
CC   genome of Drosophila melanogaster American nodavirus (ANV)
CC   SW-2009a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1416
FT                   /organism="Drosophila melanogaster American nodavirus (ANV)
FT                   SW-2009a"
FT                   /segment="RNA2"
FT                   /host="Drosophila melanogaster"
FT                   /lab_host="S2 cells"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="Feb-2009"
FT                   /db_xref="taxon:663279"
FT   CDS             22. .1245
FT                   /codon_start=1
FT                   /product="coat protein precursor"
FT                   /protein_id="ACU32796.1"
FT                   /translation="MVNNIKPKRQRSQRVVVTTTQTAPIPQQNVPRNGRRRRNRARRNR
FT                   RRGRGMNMAALSRLSQPGLAFLKCAFAPPDFQVRFGKCIPDRFEGKVVSRKDVLNQSIS
FT                   FESGKDTFILIAPTPGVVIWSASVDAGSFLTSTNTVRSSNYSGFTSMFGTTATSRSDQV
FT                   SSFRYASMNVGIYPTSKLMQFTGSITVWKCPIKLSTVQFPVATEPATSSLVHILAGLDG
FT                   VLAVGPDNFSESFIKGVFSQSACNEPDFEFKDILEGIQTLPPSNVDIGSTGQPFTLSAG
FT                   DENTSGTVGWGNMDTIVIRVSAPTGAVNSAILKAWSCIEYRPNPNAMLYQFGHDSPPLD
FT                   EVALQEYRTVAKSLPVAVIAAQNASMWERVKAIIKSSLAAASNIPGPIGVAASGISGLS
FT                   ALFEDFGF"
XX
SQ   Sequence 1416 BP; 375 A; 356 C; 327 G; 358 T; 0 other;

gq342966 Length: 1416  05-FEB-2010  Type: N  Check: 9378  ..

       1  gtaaacaatt ccaagttcca aatggttaac aacatcaaac caaaacggca
      51  acgatcccaa cgtgttgtcg taacaacaac ccaaacagcg cctattccac
     101  agcaaaacgt accacgtaat ggtagacgtc gacgcaatcg cgcgcggcgg
     151  aatcgccgtc gtggacgtgg catgaatatg gcggcgcttt cccggcttag
     201  tcagcctggg ttggcgtttc tcaagtgtgc cttcgcacca cctgactttc
     251  aggtacgctt cggaaaatgt atacctgata gatttgaagg caaagtggtc
     301  agccgaaagg atgtcctcaa tcaatctatc agtttcgaat ccggaaagga
     351  cacttttata cttatcgcac ctacacctgg agtcgttatc tggagtgcca
     401  gtgttgatgc tggtagtttt cttactagca cgaatacggt tagatcgagc
     451  aattattcgg gctttacatc gatgttcggt actactgcaa catctaggtc
     501  cgaccaagtg tcctccttca ggtacgcttc catgaacgtg ggcatttacc
     551  caacgtcgaa attgatgcag tttaccggaa gcataactgt ttggaaatgt
     601  cctataaagc tgagcactgt acaattcccg gttgctacag agccagccac
     651  ctcttcacta gtacacattc ttgctggttt agatggtgta ttagcggtgg
     701  gaccagacaa tttctcagaa tcattcatta aaggagtatt ctctcaatcg
     751  gcttgtaatg agcccgattt tgagttcaaa gacatattgg agggtatcca
     801  aacattgcca ccatctaatg tggatatagg ttctacgggc caaccgttta
     851  ccttgtccgc aggagacgaa aacaccagtg gcactgttgg ctggggtaat
     901  atggacacca ttgtcatccg tgtctctgcc cccactggcg cagtcaactc
     951  cgccatactc aaggcatggt cttgcattga gtacagaccc aatcctaatg
    1001  ctatgctgta tcaattcggc catgactcgc cacctcttga tgaggtagca
    1051  cttcaagaat accgtacggt tgccaaatct ttgccggttg ctgtcatcgc
    1101  agcgcaaaac gcatcaatgt gggagagagt taaagctatc atcaagtcct
    1151  ccttagctgc tgcaagcaac attcctggcc ctatcggtgt cgccgcaagc
    1201  ggcattagtg gactgtcggc cttatttgaa gattttggat tttagatcac
    1251  aaaccggatg ccaacctaac tgggcaatta ggccacaata agcccaatgg
    1301  gccacaataa gcccaacttg gttgatgatc gaaacagtga gccccctccc
    1351  atgtaatgga agacgtcgac gcaatcgcgc gagacgtaat gacagtttaa
    1401  gtcagccgac taaggt