Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate California P08.8 clone 10 coat protein (CP) gene, partial cds.

ACC No: GQ413959

Dated: 2009-09-13 | Length: 669 | CRC: -2139002791

                
ID   GQ413959; SV 1; linear; genomic RNA; STD; VRL; 669 BP.
XX
AC   GQ413959;
XX
DT   13-SEP-2009 (Rel. 102, Created)
DT   13-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate California P08.8 clone 10 coat protein (CP)
DE   gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-669
RA   Saponari M., Yokomi R.K.;
RT   "Genetic diversity of Citrus tristeza virus isolates collected recently in
RT   California";
RL   Unpublished.
XX
RN   [2]
RP   1-669
RA   Saponari M., Yokomi R.K.;
RT   ;
RL   Submitted (26-JUL-2009) to the EMBL/GenBank/DDBJ databases.
RL   ARS-USDA, San Joaquin Valley Agricultural Sciences Center, 9611 S.
RL   Riverbend, Parlier, CA 93648, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .669
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="California P08.8"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /clone="10"
FT                   /note="genotype: T30-like"
FT                   /db_xref="taxon:12162"
FT   gene            1. .>669
FT                   /gene="CP"
FT   CDS             1. .>669
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /note="major coat protein; P25"
FT                   /protein_id="ACV53607.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAGSSFASVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 669 BP; 195 A; 123 C; 169 G; 182 T; 0 other;

gq413959 Length: 669  13-SEP-2009  Type: N  Check: 3748  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgctg ctgggtcttc tttcgcttcc gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgagtact
     151  caacagaatg ctgctttgaa cagggactta tttcttgctc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataagga ctttcacata gctatgatgt
     251  tataccgttt agcggttaag agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc gacatcgtgt ataattctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgctcttta cttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggct gggtatcatt atttgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgt