Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate P09.18 clone 9 major coat protein (CP) gene, complete cds.

ACC No: GQ424346

Dated: 2009-09-13 | Length: 672 | CRC: -243658973

                
ID   GQ424346; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   GQ424346;
XX
DT   13-SEP-2009 (Rel. 102, Created)
DT   13-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate P09.18 clone 9 major coat protein (CP) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Saponari M., Yokomi R.K.;
RT   "Genetic diversity of Citrus tristeza virus isolates collected recently in
RT   California";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Saponari M., Yokomi R.K.;
RT   ;
RL   Submitted (27-JUL-2009) to the EMBL/GenBank/DDBJ databases.
RL   ARS-USDA, San Joaquin Valley Agricultural Sciences Center, 9611 S.
RL   Riverbend, Parlier, CA 93648, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="P09.18"
FT                   /serotype="MCA13 positive"
FT                   /mol_type="genomic RNA"
FT                   /country="USA:Southern California"
FT                   /clone="9"
FT                   /note="genotype: T36 nonstandard"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="major coat protein"
FT                   /note="P25"
FT                   /protein_id="ACV53853.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSMNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 199 A; 129 C; 166 G; 178 T; 0 other;

gq424346 Length: 672  13-SEP-2009  Type: N  Check: 9796  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgac gttgttgccg ctgagtcttc tttcggttcc atgaacttac
     101  acatcgatcc aactctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gcatcctaac ttacctgaca aagataagga ttttcacata gctatgatgt
     251  tgtatcgttt agcagttaaa agttcatcat tacaaagcga tgacgacact
     301  acgggtataa cgtacactcg ggagggtgtc gaagtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggt aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgt tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga