Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate P09.20 major coat protein (CP) gene, complete cds.

ACC No: GQ424352

Dated: 2009-09-13 | Length: 672 | CRC: 1001749244

                
ID   GQ424352; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   GQ424352;
XX
DT   13-SEP-2009 (Rel. 102, Created)
DT   13-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate P09.20 major coat protein (CP) gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Saponari M., Yokomi R.K.;
RT   "Genetic diversity of Citrus tristeza virus isolates collected recently in
RT   California";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Saponari M., Yokomi R.K.;
RT   ;
RL   Submitted (28-JUL-2009) to the EMBL/GenBank/DDBJ databases.
RL   ARS-USDA, San Joaquin Valley Agricultural Sciences Center, 9611 S.
RL   Riverbend, Parlier, CA 93648, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="P09.20"
FT                   /mol_type="genomic RNA"
FT                   /country="USA:Central California"
FT                   /note="genotype: T30-like"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="major coat protein"
FT                   /note="P25"
FT                   /protein_id="ACV53858.1"
FT                   /translation="MDDETKKLKNKNKKAKEGDDVVAAESSFGSVNLHIDPTLMTMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYTSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 195 A; 123 C; 171 G; 183 T; 0 other;

gq424352 Length: 672  13-SEP-2009  Type: N  Check: 3541  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaaga aagcgaaaga
      51  aggcgacgat gttgttgctg ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgatg acgatgaacg atgtgcgtca gttgagtact
     151  caacagaatg ctgctttgaa cagggactta tttcttgctc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataagga ctttcacata gctatgatgt
     251  tataccgttt agcggttaag agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc gacatcgtgt atacttctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgctcttta cttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggct gggtatcatt atttgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga