Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate RIV 11-3 major coat protein (CP) gene, complete cds.

ACC No: GQ424358

Dated: 2009-09-13 | Length: 672 | CRC: -1533216455

                
ID   GQ424358; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   GQ424358;
XX
DT   13-SEP-2009 (Rel. 102, Created)
DT   13-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate RIV 11-3 major coat protein (CP) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Saponari M., Yokomi R.K.;
RT   "Genetic diversity of Citrus tristeza virus isolates collected recently in
RT   California";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Saponari M., Yokomi R.K.;
RT   ;
RL   Submitted (28-JUL-2009) to the EMBL/GenBank/DDBJ databases.
RL   ARS-USDA, San Joaquin Valley Agricultural Sciences Center, 9611 S.
RL   Riverbend, Parlier, CA 93648, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="RIV 11-3"
FT                   /mol_type="genomic RNA"
FT                   /country="USA:Southern California, Riverside"
FT                   /note="genotype: T30-like"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="major coat protein"
FT                   /note="P25"
FT                   /protein_id="ACV53863.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 197 A; 121 C; 170 G; 184 T; 0 other;

gq424358 Length: 672  13-SEP-2009  Type: N  Check: 4341  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggtgacgat gttgttgctg ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgagtact
     151  caacagaatg ctgctttgaa cagggactta tttcttgctc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataagga ctttcacata gctatgatgt
     251  tataccgttt agcggttaag agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc gacatcgtgt ataattctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgctcttta cttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggct gggtatcatt atttgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga