Sequence of DPV Citrus tristeza virus

Citrus tristeza virus strain HA18-9, complete genome.

ACC No: GQ454869

Dated: 2010-01-01 | Length: 19245 | CRC: 1754997080

                
ID   GQ454869; SV 1; linear; genomic RNA; STD; VRL; 19245 BP.
XX
AC   GQ454869;
XX
DT   13-OCT-2009 (Rel. 102, Created)
DT   01-JAN-2010 (Rel. 103, Last updated, Version 2)
XX
DE   Citrus tristeza virus strain HA18-9, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19245
RX   PUBMED; 19834797.
RA   Melzer M.J., Borth W.B., Sether D.M., Ferreira S., Gonsalves D., Hu J.S.;
RT   "Genetic diversity and evidence for recent modular recombination in
RT   Hawaiian Citrus tristeza virus";
RL   Virus Genes 40(1):111-118(2010).
XX
RN   [2]
RP   1-19245
RA   Melzer M.J., Borth W.B., Sether D.M., Ferreira S., Gonsalves D., Hu J.S.;
RT   ;
RL   Submitted (06-AUG-2009) to the EMBL/GenBank/DDBJ databases.
RL   Plant & Environmental Protection Sciences, University of Hawaii, 3190 Maile
RL   Way, St. John 310, Honolulu, HI 96822, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19245
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus latifolia"
FT                   /strain="HA18-9"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="03-Apr-2001"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .107
FT   CDS             108. .9458
FT                   /codon_start=1
FT                   /product="349 kDa polyprotein"
FT                   /note="ORF1a"
FT                   /db_xref="UniProtKB/TrEMBL:D0EAL9"
FT                   /protein_id="ACX48884.1"
FT                   /translation="MSKLRGSFWSSAFAASSEYTISRIWRKLNTIVVLHYFGSVRITKV
FT                   IRDESADMPIVPLRKSVFPFSVRAAVRAIRAAGRPLDAPHSGCLCGNPVINASGVVRPR
FT                   SVAGFSRFSLCKPPLSSAAKKSIRQAKRESVSPFSRASSLFSREVPRGTRSKLRRRVVR
FT                   RTDTTLPESPQDEPNRKNRRFGQTSHLPYMGEAALDDILRWIEGVNPHPSMVAIPVPIA
FT                   FGTMSATAWCSNSDAAVLRCRLNYHAAETDFSTQEKHVRYVYNDVSSAANRPRTVSSRK
FT                   CGSIFPSKSKLGVEVPSGRDRHTAFVRSSHASAFFSDAVRRVRLFRPARNNFFTSVVSG
FT                   RRVCYYRPGPCGTVSVFMSDGVNTARLDVVAPAYYAYAKSLGAKVRFLWESSDLDDAKI
FT                   RDGQCYIRHVFDVALYFGRRADFSVRRALGLYPTVGAFKAYLVREYGRDSLKVPVRGTY
FT                   TFGSVFHCLSTESSVDLRSIPNHHLVGGTSAHVLIGQIRINVPGSTTKPSRSAVRRRNR
FT                   RMRRDGYLGSSGSSSSARESNYCSDCSSPRSIPSPSILKPSLGRVPSIDRRFRFPAGTQ
FT                   LRVSVPRRVDDHVYVSTGQNFDELCHAVCTYVKRYNSRKSFYTRFESGGDYVVLRRASV
FT                   GGLHVFVKRGNFTARFPISAVRYENHYAATMTDVGTSWVPKGYVPDVEIVKRRRSRNRR
FT                   LLLSRRVVDQSVPALPSSPVEVTSASSDRSSSSEKASTPSLDSVRSSDWVNVGFSRRTT
FT                   TKVRESRFTGRGKIGNFTFPRGTVYNASVDERAYKRVLKLRDTTACSFLRILLARLSSY
FT                   RPLSDDFFNKCVTSRFVACIEPVESGLVKVHFRSDVFRASFPFGVNLYTRHAFDIGSGS
FT                   LLGLDTYGFSESLKEGYCYIRHFAEVSLSMGRIFFRRDVDLGPFPRIFEVQHRLERLYG
FT                   KAASRYGVRGYYSAPRCFHCCYDDSPKPLTSFNKYHNMGGEDNSLIITDTDRLRAVGSA
FT                   YEKVKRNIPDSLLIRSVEKDLIEFNQTLVDMHRSRPGVVVPFQMSENQQVMLTRAYPEF
FT                   NINFIHSVHSDHPVAAGSRALENHLVRKHAGTDYSDVGGCPLFHLRAGHSGVHVCRPVY
FT                   DVKDAHRRVVRHHQLNKVSLDQSDGVKQVGAVNTNSVCGNTLGDCYHVSEAIVMVQVYD
FT                   VPLHELCRAMINKKTSVCYMTMVTPGELLDARESFFIKDLDCSVELDPVADQVVYCFNN
FT                   SAYTHTYSTICEYMRTPCLVVDGFLFTIEMVSLRCSVNYYCITKSSVCPRISETKRLRY
FT                   RRCDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYVVNSCVVVNAKTFEWTW
FT                   NYIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRLAAFSGD
FT                   TSIFELVKFAISEKCRDIFMGIQDAVERCVKSYLRNSFNMSFVDLSDPLLTISEYSELD
FT                   VPINLPGFGRIVDGDETRLMEDGVKSALLRKAVRDEAQLNLKRGNTSEIVPCEDDDDSN
FT                   GDDSLVSRDSDGGSSSGGSSGGLRAGAAPSLFRRLLRKLGGGLCLAKKVLELLLKRVVE
FT                   SFSRLKRKTTRLTSFANLLLARLSCGFFDDSVFSAVREIAVNLTRIVDGVVKTKLECFR
FT                   NLFRLIPKLYVGCRDVVKDVSNAYRSAVLFSAEIFGKSYSKLCQFCLETFDVGLIEISA
FT                   RNLGLETCVSMAQAIFDVLVAFPLGSVSFSVVCARVFGALAMEVGSNFLFKKAFGKPET
FT                   LGEDAFRRTVSMVLSAKAFDKLSVDAKGLVRCSGVIPGVLRIILSSLFSEADAWVGYSK
FT                   HEVSSLPIVTFCVKKLSYSLEQCKEACIAFVVDSAKKVLKSLTSEFNESIQNSDLTSGA
FT                   KSLYGHVSSILSTSSGVINKAGNAVATVNAVGSDISGRVKRLRPRFSLSRHFDEQTSEY
FT                   YSASDCSELDESLLSETPGLRGNGRCRDLLRIVSRRAVACSEYLINLLKQLTSRASEYS
FT                   YSYAMDLLVRLYVATDDVVRRCRSFTFDCTDKASNFFVGCLSWYNLRSGAYSATPGLGG
FT                   GSRSLTTVFPTGGFVRVIGALGNVLSVVFDEEFLRTLLHRLRTDVVVLLVEFLKNLPVC
FT                   LFSIYTFFECRGRVFPLREFLWGFCRFVWEVVEGLSINVYQHLSAVVVKAYRCAFSHRF
FT                   SDEDERTLRVITEAEGRIEFLRVVLAEMERFRAASNEVSLSRSSDSPSFPPTYGEIVEL
FT                   NDDSSDSALVIGVDNGTGRAIVDSETDSASGSDSDVSIPLDRDFEQIGGLGGNGNVGVF
FT                   RLGLRFTLRLLRNLFNARGFKVLYGLLLQTLFYGGSVNKFVSRLVFSLGTCLPFELFRF
FT                   ACSARRLFKSLASFVYQTNLFSEATVEHLFSFSRLLYDSRYFSSVFSEIERFDFYLDHF
FT                   LSLPKRYLFLNSRVRCRARAPVLVTRTEEVTPVCKRSLNDILDSLDSLKVSDLKGKSTF
FT                   VDDGESDSGSERSGSSISFGSIDEEVLNAVNGDGVCEKAPLMKHATALSKLEPDPSGRK
FT                   DNPVSKKTFTRGECSGVKSKVGMCDYLVTLNSSFGTVPDMYPVARDITYKKLTNAMREF
FT                   YYSQKITLYELHGKLSSYWDELKVAGFDRKLTRMDLDDDVYVVDFNRKLLVGRNGSHPF
FT                   RNTLKSYCFMFCNDGLVPCPGSQKYDYALISNQTSFVAANSFLRAVDGKDLTFTNEGHS
FT                   LIVYEAPPGGGKTHSLVNCYADYCDKVSCLVVTANKNSQTEISQRISSELMSRKRAAKY
FT                   VTGAASRVFTVDSYLMNHLRLTTQLLFVDECFMVHAGAIGAVVEFTSCKAVVFFGDSKQ
FT                   IHYIHRNDLGVSLLHDIDAFIQPEHCIYGEVSYRCPWDICEWLSEFYPRHVATANVGSV
FT                   GKSSVSIEEINGCDDVPYDKAAKYIVYTQAEKNDLQKHLSRLTVGRTKVVPIVNTVHEV
FT                   QGETYKRVRLVRFKYQEDTPFSSKNHIVVALTRHVDSLVYSVLTSRRYDDTATNIDRAK
FT                   EIFDKFRSTNHSYGSSSLEWYLEKFPTEYKGSKASSAPISCINEFLNEVVVGSSVVQLG
FT                   DVSEELSSRPFESGCDNVTVRDTAPPDSGNLHEPARVRRSKVTSNSSKKSVATRKPSVV
FT                   RES"
FT   CDS             <9331. .10815
FT                   /codon_start=1
FT                   /product="RNA dependent RNA polymerase"
FT                   /note="ORF1b; RdRp; likely expressed by +1 frameshift"
FT                   /db_xref="UniProtKB/TrEMBL:D0EAM0"
FT                   /protein_id="ACX48885.1"
FT                   /translation="ETLPLPTPVTYTNRLAFGVVRSQAIPPRKASLQENLLSYESRNYN
FT                   FIKTERFVGPSEFGRAMAAAVIERCFKMEEMAKIRCDIISLTGANILKWLDKRTPCQIK
FT                   AVQAELKLPFSVEEQITNYKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIFSPC
FT                   FDEFKNRVLSSLNDNIVFFTEMTNAGLAEVVRRIIGDDDNFFVGEVDFSKFDKSQDLFI
FT                   KEYERTLYSEFGFDTELLDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLV
FT                   TLGILSLYYDVSKFELLLVSGDDSLIYSSEKISNFSSEICLETGFETKFMSPSVPYFCS
FT                   KFVVQTGNKTCFIPDPYKLLVKLGAPQNKLTDEELFELFTSFKDITQDFGDQVVLEKLK
FT                   LLVEAKYGFTSGTTMPALCAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRKFANLI
FT                   CERMVYDNRVGYFSYFDNPFTKPDASDGQMDDLMTS"
FT   CDS             10864. .11775
FT                   /codon_start=1
FT                   /product="p33"
FT                   /note="ORF2"
FT                   /db_xref="UniProtKB/TrEMBL:D0EAM1"
FT                   /protein_id="ACX48886.1"
FT                   /translation="MFASASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDVDDR
FT                   DPTVLADYFSLYFFLLNNDNVGPLAATIIVSPPVSGTYKIRAHVDNQPNCEGNVTYVKT
FT                   VDKSRFAILIKSVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENL
FT                   SKVCSSSFSFRAVSKTAINEFSVATDDVEDVKYVRKQAEGFSHCADPYPPRCYRGANLG
FT                   DSSGVQSRTIEEEGYRTDTAGNVAVTIPNTPLVSAVSPYVAEYNENTRSRISLIRRVCC
FT                   YAVCVLVVSLLIMSGLLAIIFI"
FT   CDS             11845. .12000
FT                   /codon_start=1
FT                   /product="p6"
FT                   /note="ORF3"
FT                   /db_xref="UniProtKB/TrEMBL:D0EAM2"
FT                   /protein_id="ACX48887.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTEPVRNTSPY
FT                   DTHATV"
FT   CDS             12006. .13790
FT                   /codon_start=1
FT                   /product="heat shock protein 70-like protein"
FT                   /note="ORF4; HSP70h"
FT                   /db_xref="UniProtKB/TrEMBL:D0EAM3"
FT                   /protein_id="ACX48888.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASREPGSFYKDLKRWVGCTEKNYQSYLHKLSPSYKVIVKEFGAKSMP
FT                   VPYLSPLNNDLGLSVALPSLIALYTKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSVSLSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELAEFLPQKELNVSSLKEALSLQTDPVKYTVTNYG
FT                   ISETVSIDQTTLREIASVFITRTIDILTQVKVKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LETVPFVSGIIPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPNDVEMTLVTRVDSMGKVEFYLKGPSGELVNVQGTSHYDYVGMPHPTRKLLRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDVLLADLRKTASLSEYSKKYPITRNDVDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             13714. .15321
FT                   /codon_start=1
FT                   /product="p61"
FT                   /note="ORF5"
FT                   /db_xref="UniProtKB/TrEMBL:D0EAM4"
FT                   /protein_id="ACX48889.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRNFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPRGTFENELALLHNSVVINDFVEFTGMPLDSLMTGIEDREVPDELISV
FT                   DPHEVGCKFTLNDVESYLMSRGEDSADVTAVEHSWCLSNSCGRLLSSTEIEAYKTMVFT
FT                   KNFDSSVSGVTTKLETYLSYCISLYKKHCMKDDDYFNLILPMFNCLMKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDEG
FT                   VLIPFDPMDFVLDLPKLNIHDTMVVVGNQIRRLEHVVESDALDDLSQHVDVRLAAANPD
FT                   LRIDLRWAGMFVYYGIYRCAADREVERPALFRLPQKLLNQDDGESCSLCMSSVEALFSL
FT                   VQKVNRDINIRRQFMGRHSKVALRLYRSLGLKFPTISSVRLPAHHGHLYVDFYKRVPDD
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRLRRGSSRTFRGRGARGASSRHLSRD
FT                   VATSGFNLPYHGRSYNTS"
FT   CDS             15296. .16018
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="ORF6; CPd; duplicate coat protein"
FT                   /db_xref="UniProtKB/TrEMBL:D0EAM5"
FT                   /protein_id="ACX48890.1"
FT                   /translation="MAGHTILPKTDDKEMDPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEHLKYVMVTMDIFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGSRYKLLDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLAADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYV"
FT   CDS             16111. .16782
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="ORF7; CP"
FT                   /db_xref="UniProtKB/TrEMBL:D0EAM6"
FT                   /protein_id="ACX48891.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGMT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16748. .17251
FT                   /codon_start=1
FT                   /product="p18"
FT                   /note="ORF8"
FT                   /db_xref="UniProtKB/TrEMBL:D0EAM7"
FT                   /protein_id="ACX48892.1"
FT                   /translation="MSGSLGNLTHVDILRSDSRFISGWWSFVVNVGDIIVRFALHVPSE
FT                   EMLNDFSAISNCTIIADGSALLKDNIVFDRLEGMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVVMGTNVDDTRCGCSIWFYNNGMFRNGLTRCDNLVTL
FT                   FSAT"
FT   CDS             17285. .17644
FT                   /codon_start=1
FT                   /product="p13"
FT                   /note="ORF9"
FT                   /db_xref="UniProtKB/TrEMBL:D0EAM8"
FT                   /protein_id="ACX48893.1"
FT                   /translation="MSIRRVWLKVVAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NISYAKKCYDLANFDLDFLRVVVIPLSGSTANESRADRANISEIVESHVSDRDRMNILL
FT                   RNKRIQIPSLLPCGN"
FT   CDS             17720. .18268
FT                   /codon_start=1
FT                   /product="p20"
FT                   /note="ORF10"
FT                   /db_xref="UniProtKB/TrEMBL:D0EAM9"
FT                   /protein_id="ACX48894.1"
FT                   /translation="MRAYFSVNDYISLLANVGAAVERLCDPSVTLTEVIDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSAVD
FT                   VMGFFVMRYMSSSHTSFESVMRTELKLVVKVVLSDLSRAHKLDFSERAFTAYGILLQKG
FT                   TVSTVCGQFDINLVSPSCV"
FT   CDS             18349. .18978
FT                   /codon_start=1
FT                   /product="p23"
FT                   /note="ORF11"
FT                   /db_xref="UniProtKB/TrEMBL:D0EAN0"
FT                   /protein_id="ACX48895.1"
FT                   /translation="MDSTSGQTFVSVNLSDESNTASTAVRTVSSEADRLEFLRKMNPFI
FT                   IDALVRKTSYQGARFRAKIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNEGKARAFSNAEMFAIDLVMYTKEKQLAINLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDVNAVDVGDNEDTSSEYPVSLSVSGGVLREHHFV"
FT   3'UTR           18979. .19245
XX
SQ   Sequence 19245 BP; 4738 A; 3799 C; 4805 G; 5903 T; 0 other;

gq454869 Length: 19245  01-JAN-2010  Type: N  Check: 3331  ..

       1  aatttcacaa attcaacctg ttcgcccaga aaatacgtct ggcacaacag
      51  ggatccggaa taggtccagc ctttaagctc taatattccc acaacaaaaa
     101  ttacactatg tcgaaactca gaggaagctt ctggtcttcg gctttcgctg
     151  ctagcagcga atacacgata tcgcgcatct ggcgcaaact taacaccata
     201  gtagtcctgc actactttgg ttctgttaga atcaccaagg tgattcgtga
     251  cgaatcggcc gatatgccga tagtccctct acggaaatct gtatttccgt
     301  tctctgttcg cgcggctgtt cgcgcaattc gtgccgctgg gcgtcctctc
     351  gacgctccgc attctgggtg cctctgtggc aatcccgtta tcaacgcatc
     401  tggcgttgtt cgtccccgct ctgtcgcggg tttttcgagg ttttctctgt
     451  gcaaacctcc cctctcctcc gccgctaaga agtccatccg tcaggcaaag
     501  cgggaatctg tttccccttt tagccgggct tcttctctct tctctaggga
     551  agtccctcgc ggcacacgtt ctaaacttcg aagacgtgta gtgagaagaa
     601  ctgacaccac cctaccagag agtccccaag acgagccgaa ccgaaaaaac
     651  cgccgatttg gtcagacttc tcacctccct tatatggggg aggcagcgtt
     701  ggatgatatc cttcgctgga ttgaaggggt taatcctcat ccctcgatgg
     751  tcgctatccc agtgcccatc gctttcggaa ccatgtccgc aacggcatgg
     801  tgttctaatt ctgatgccgc tgttttgcgg tgccgcttaa actatcacgc
     851  ggctgaaact gatttctcca ctcaggagaa acatgtgcgg tacgtctata
     901  atgacgtatc ttctgctgct aaccgtcctc gtacggtttc atcccgcaaa
     951  tgcgggtcta tttttcccag taaatctaaa ctgggcgttg aggtcccctc
    1001  tggtagggac cgtcacactg cgttcgtgag atcttctcac gccagcgctt
    1051  tcttctcgga cgcggttcgc cgcgttcgtt tgttccgccc tgcgcggaat
    1101  aattttttca cttccgtcgt cagcggacga cgcgtttgct actacagacc
    1151  cggtccttgt ggtacggtgt ctgtcttcat gtcggacggt gttaacacag
    1201  cacgtctcga cgttgttgct ccggcgtact atgcgtacgc taagtctttg
    1251  ggcgccaaag tgcgcttttt gtgggagtcg tccgatttgg acgacgctaa
    1301  aattcgtgac ggtcaatgct acatccgtca cgtgttcgac gtggctctct
    1351  actttgggag acgcgccgac ttttctgtgc gtagagcact gggcttgtac
    1401  cccacagtgg gtgcatttaa agcttatcta gttcgcgagt acggtcgcga
    1451  ctctcttaag gttcctgtgc gtgggaccta cacttttggc agtgtttttc
    1501  actgcttgtc aactgaatct tcagtcgacc tgcgatctat ccctaaccat
    1551  catttagttg gtgggacatc tgcccatgtc ttaattgggc aaattcgaat
    1601  caacgttcct ggttctacta ctaaaccctc acggtcggct gttcgtaggc
    1651  gtaacagacg catgcgacgt gacggttatc tcggtagttc cggttcttct
    1701  tcttctgcaa gggaatcgaa ttactgctcg gattgctctt ctcctcgcag
    1751  tataccgtct ccttccattt taaaaccttc cctaggtcgg gtcccgagca
    1801  tagatcggcg gttccggttt cctgcgggta cgcagctgcg cgtttccgtg
    1851  cctaggcgag tcgatgacca tgtttacgtg tcgaccggtc aaaactttga
    1901  tgagttgtgc cacgcagttt gcacatacgt caaaaggtac aactctagga
    1951  aatcctttta cactcgattc gagagtggtg gagattacgt tgttctgcgg
    2001  cgtgcatccg ttgggggcct tcacgtgttt gtgaagcgtg gtaactttac
    2051  tgctcgattt cctatttcgg cagtcaggta tgagaatcac tacgccgcga
    2101  ctatgacgga tgttgggact agttgggttc cgaagggtta cgttcccgat
    2151  gttgagattg tgaagcgtcg gagaagtcgt aatcgtcgtc ttcttctatc
    2201  ccgtcgtgtg gtggaccaat cggtcccagc attaccatca agtcccgtcg
    2251  aggttacttc ggcttcgagt gataggtctt cgtcatcaga gaaggcttcc
    2301  acaccttcac ttgactcagt aaggagttcg gactgggtga atgttggctt
    2351  ctctcgccga actactacta aggttcgtga atcgcgtttt actggtcgtg
    2401  gtaagatagg aaattttact ttcccgagag gcactgtgta caatgcatct
    2451  gttgatgaac gtgcctataa acgtgttctt aagttgcgag atactacagc
    2501  ctgttccttt ctccgcatac tgctagctcg tttgtcgagt tacaggcctt
    2551  tgagtgacga tttctttaat aagtgtgtca cttctcgatt tgtcgcgtgt
    2601  attgaacctg tggaatcggg tctagttaaa gtgcacttcc gttctgatgt
    2651  tttccgtgct tctttcccgt ttggggttaa tttgtatacc cgccacgcgt
    2701  ttgacattgg aagtggtagt cttttgggat tggatactta tggcttttct
    2751  gaatccctga aggaaggata ttgctacatt cgccatttcg ccgaagttag
    2801  tttgagcatg gggcggattt tcttcaggag ggatgtcgat ttgggacctt
    2851  tccctcgcat tttcgaagtg caacaccgtc ttgaaaggtt gtacgggaaa
    2901  gctgcgtcaa gatatggtgt tagaggttac tactcagccc cgcgctgctt
    2951  tcactgttgc tacgatgatt cgccgaaacc gttgacttcc tttaataagt
    3001  accataatat gggcggcgaa gataactcac tgataatcac ggacaccgac
    3051  aggttgcgtg ctgtggggag tgcctatgaa aaggtgaaaa gaaatatacc
    3101  cgattcgtta ttgattcggt ctgtggaaaa agacctcata gagtttaatc
    3151  agactctggt tgatatgcat cgatccagac cgggcgttgt cgtacctttt
    3201  cagatgagtg agaaccagca agtaatgctc actagggcgt acccagagtt
    3251  taatattaat tttattcact ccgtacattc tgatcatcca gtagctgcgg
    3301  gttctagggc gttggagaat catctcgttc gtaaacacgc tggtaccgat
    3351  tattcggatg tggggggttg tccgctgttt catttacgcg cgggtcactc
    3401  cggtgttcat gtttgtagac cggtgtacga tgttaaagac gctcaccgta
    3451  gagtggtccg tcatcaccaa cttaacaagg tttcgctaga tcagagcgac
    3501  ggtgttaaac aagttggtgc ggtaaacacg aattccgtat gcggtaacac
    3551  tttgggagat tgttatcatg tatcggaggc gatagttatg gttcaagttt
    3601  atgacgtacc gctacatgag ttgtgtaggg ctatgataaa caagaaaact
    3651  tccgtgtgtt atatgaccat ggtcacgcct ggtgagttgt tggatgcccg
    3701  tgagtccttt tttattaagg acttggattg ttcggtcgag ttggatcccg
    3751  tcgcggacca ggtcgtttac tgtttcaaca attccgcgta tacacacacg
    3801  tactccacta tatgtgagta tatgcgtact ccttgcttgg tggtggatgg
    3851  gtttttgttt actattgaga tggtgtcgct caggtgtagt gttaattact
    3901  attgcatcac taaatcgtcg gtttgtccaa gaattagtga gactaagcgg
    3951  ttacgctacc gtcggtgtga cagcgacttg atcagaatca agattccccg
    4001  gtactctagt aaaacccgta gttgtttacc tgggtgttac tatttgtact
    4051  tggacgccaa gttcgtaagt cgcgtgtacg agtacgtggt caatagctgc
    4101  gtcgtggtga acgcaaaaac ttttgagtgg acttggaatt acatcaaatc
    4151  ttgcaagtcg agagtggtga tcagcgggaa gattatacac cgagacgttc
    4201  caatcgcttt agagtactta gacgggtttt ctgctgttat gttgtccgct
    4251  ggtgtgaagg gtaggcaaaa cgcagaagcg ttttctagac gcttagccgc
    4301  cttttcaggt gacacttcaa tttttgagtt agtgaagttt gctatttccg
    4351  agaagtgccg cgacatattc atgggcattc aggacgctgt ggaaagatgc
    4401  gtgaaatcgt accttaggaa ctcttttaac atgagtttcg tggacttgtc
    4451  cgatccctta cttacgatta gcgaatattc ggagttggac gttcctatca
    4501  acttaccagg tttcggtagg atagtggatg gtgacgaaac tagacttatg
    4551  gaagacggtg ttaaatcggc attgttgcgg aaagcagttc gagacgaggc
    4601  acagttgaat cttaagagag gtaacacttc cgaaatcgtt ccgtgtgaag
    4651  acgatgatga ctcgaacggt gatgattcac ttgtttcgcg cgattcggat
    4701  ggtggttcgt cttcgggcgg tagttccggc gggttgcgag ctggagctgc
    4751  cccttctttg tttaggcgtt tactcaggaa gctgggtggg ggtttatgtt
    4801  tggcaaagaa agtgttggaa ctgttactca agcgggtggt tgaatcgttt
    4851  tcacgtctga aacgaaagac cactcgttta acgtctttcg ctaatttgtt
    4901  gcttgcgagg ctttcttgcg ggtttttcga tgattccgtt ttttctgcgg
    4951  tccgggaaat tgcggtcaat ctgaccagga tcgtcgatgg agtagttaag
    5001  acgaaattag agtgctttcg aaatttgttt cgattgattc ctaagttata
    5051  tgtcggttgt agggacgttg tgaaggacgt tagtaacgct tacaggtcgg
    5101  ctgttttgtt ttccgctgaa atttttggta agagttactc taaactttgt
    5151  cagttttgct tggaaacgtt tgacgtgggg cttattgaga tttccgctcg
    5201  taatttggga ttagaaactt gcgtctcaat ggcacaggct atttttgatg
    5251  tgttggtcgc ttttcctttg gggagcgtta gtttttccgt cgtttgtgct
    5301  agggttttcg gtgctctcgc tatggaagtg ggatcgaact tcttgtttaa
    5351  gaaagctttc ggtaaacccg aaactctagg tgaagatgcc ttccgtagga
    5401  ccgtaagtat ggttttgagc gccaaagcgt ttgacaagct ttccgtagat
    5451  gcgaaaggct tagttaggtg ctctggtgtt attcctgggg tgttaaggat
    5501  aatactatct tccttgtttt ccgaggcaga cgcttgggtg ggttacagta
    5551  aacatgaagt ttcttccctt cctatagtta ccttctgcgt gaagaaattg
    5601  tcttattctt tggagcagtg taaggaagcg tgtatcgctt tcgttgtcga
    5651  ttctgctaag aaggttctga aatctttaac ttctgagttc aacgaatcta
    5701  ttcaaaactc cgacttgact agtggtgcta agtccttgta cgggcacgtg
    5751  agctcgatac tttccacctc tagcggtgtg attaataaag ccggaaacgc
    5801  tgtcgctact gttaatgcag tcgggagtga tatcagtggt cgtgtgaaac
    5851  gcttgcgacc tcgtttttct ctctcccgtc actttgacga gcagactagt
    5901  gaatactact ctgctagtga ttgttccgaa ctggatgagt cgttgctcag
    5951  tgaaacacct ggtcttcgtg gaaatgggag gtgtagagat ttacttcgta
    6001  tcgtatctag acgcgcggta gcgtgtagcg aatacttgat aaatcttttg
    6051  aaacaattaa catcgcgtgc cagtgaatac tcctactcgt atgcgatgga
    6101  tttgcttgtg aggttgtatg ttgcgacaga cgacgtcgtt aggcgatgca
    6151  ggtcctttac attcgactgt actgataaag catccaattt tttcgtcggg
    6201  tgtcttagtt ggtacaactt gcgttctggt gcctactccg caactcctgg
    6251  gttgggtggt ggtagtagaa gtttaacaac ggtttttccc accggtggtt
    6301  ttgtgcgcgt tattggggca cttgggaacg tcttatcagt ggtgtttgat
    6351  gaggaattct taagaacttt acttcatcgg ttgaggacgg acgttgtggt
    6401  tttactggtg gagttcttga aaaaccttcc cgtgtgtttg ttttcaatat
    6451  acactttctt tgagtgtcgg ggtagggttt ttcctttgag agagttcttg
    6501  tggggctttt gtcgtttcgt ttgggaagtc gtcgaagggt tgtccatcaa
    6551  tgtctatcaa catctctctg ctgtcgttgt gaaagcgtat cgatgtgcgt
    6601  tcagtcatcg gtttagcgat gaggatgaga ggacactccg agtgatcaca
    6651  gaggcggaag gaagaattga gtttttgcga gttgttctcg cggaaatgga
    6701  aaggttccgt gctgcgtcaa acgaggtgtc tttgtcgagg tcatctgata
    6751  gtccttcatt cccacctact tacggagaaa ttgtggaatt gaatgacgat
    6801  tcctccgaca gtgcactagt gataggtgtg gacaatggca ccggccgtgc
    6851  gatcgtcgac agtgagaccg attctgcgtc tggtagcgac agtgacgttt
    6901  ctattccgtt ggatcgcgat tttgagcaaa tcgggggtct tggtggaaac
    6951  ggtaacgtcg gtgtctttcg gctgggtttg agatttactc tgaggttgtt
    7001  gcgcaacctt tttaacgcta gaggttttaa agtgttgtac gggttgttac
    7051  ttcagaccct tttttatggt ggttcggtga ataaattcgt gtctcgtttg
    7101  gtctttagtc ttgggacttg cttacctttc gagttattcc ggtttgcgtg
    7151  ttcggcgagg cggttgttca agagtttggc atcatttgtt taccaaacta
    7201  accttttcag cgaagctacg gtggagcatt tgtttagctt ttcccggtta
    7251  ctttatgatt cccggtactt ctcgagtgta ttttcggaaa tagagagatt
    7301  tgatttctat ttagatcatt tcctttcact cccgaagaga tatcttttcc
    7351  ttaactctag ggttcgatgt cgtgctaggg ctccggttct tgtgactagg
    7401  accgaagaag tgacaccagt ctgtaagaga tcattaaacg acatattgga
    7451  ctctttagat tctctgaagg tgtcagacct caaagggaag tcgacattcg
    7501  ttgatgatgg ggagtcggat tccggtagtg aacgttcggg tagttcgatc
    7551  tcgttcggtt ccatcgacga ggaagtctta aacgcggtaa acggtgatgg
    7601  cgtttgcgaa aaagctccgt tgatgaaaca cgctaccgcg cttagcaagt
    7651  tggaacccga ccctagtggt cgtaaagata atcctgtttc caagaaaacc
    7701  tttacgcgcg gtgagtgttc gggcgtgaag tcgaaggtgg gcatgtgtga
    7751  ttacctggtg accttgaatt cttcgtttgg tacagtaccc gacatgtacc
    7801  ctgttgcgcg tgacataacg tataagaaat taactaacgc catgcgcgag
    7851  ttttattact cgcaaaaaat aaccttgtac gaacttcacg gaaagttgag
    7901  ttcttattgg gacgagttga aggtcgcagg tttcgataga aagttaacga
    7951  gaatggactt ggacgatgat gtctatgttg ttgatttcaa tcggaagctg
    8001  ttggtgggga gaaatgggtc tcatccgttt cgtaatacgt taaagtccta
    8051  ttgttttatg ttctgcaatg atgggttggt tccttgcccg ggttctcaga
    8101  agtatgatta tgctttgatt tctaatcaaa cgtcttttgt tgccgcgaac
    8151  tcgttcttac gtgctgtgga tggtaaagat ttgactttta ccaatgaggg
    8201  acacagcctt attgtttatg aggcacctcc tggtggtggt aagactcatt
    8251  ctttggtgaa ttgttacgcg gattattgcg ataaagtatc ttgtttagta
    8301  gtgacagcta ataagaattc tcaaactgag atatctcagc gtatatctag
    8351  tgagttgatg agtaggaagc gagctgctaa gtacgttact ggtgcggctt
    8401  ctagagtgtt cactgtggat tcttacttga tgaatcattt gcgacttacg
    8451  actcagttgc tgtttgtcga tgagtgcttt atggttcacg ctggagcaat
    8501  cggtgccgtg gttgaattca cgtcttgtaa agcggtagtg ttctttggtg
    8551  acagcaagca aatccactat attcaccgaa acgatctcgg ggtttctttg
    8601  ttgcatgata ttgatgcatt tatccaaccg gagcattgta tttacggcga
    8651  agtatcctac aggtgtcctt gggacatctg tgagtggctt tctgagtttt
    8701  acccgcgaca cgtagctact gctaatgtcg ggagtgttgg gaaatcgagt
    8751  gtgtcgatag aggaaatcaa tgggtgtgat gacgtacctt acgacaaggc
    8801  agcaaagtac attgtgtaca ctcaagctga aaagaacgat ctgcaaaaac
    8851  atctcagtcg tttaaccgtg ggtcggacca aagtagtacc aattgtaaat
    8901  accgttcatg aggttcaagg agagacttat aaaagggtac gcctggtgag
    8951  gtttaaatat caggaggaca ccccgttttc ttcgaagaat catattgtgg
    9001  ttgctttgac tagacatgtt gattctttgg tttactccgt acttactagt
    9051  aggaggtacg acgatactgc gactaacata gatagggcaa aggaaatttt
    9101  tgataagttt cgttcgacga atcactcgta cggttcgtca tcgttagaat
    9151  ggtaccttga aaaatttcct accgaatata aaggtagtaa agcatcctct
    9201  gctccgataa gctgcattaa cgaattcctt aatgaggtag tcgttggttc
    9251  ttctgtcgtg cagttgggtg atgtgtctga agaactgagt tcacgtccct
    9301  ttgaatcagg gtgtgataat gttaccgtaa gagacactgc ccctcccgac
    9351  tccggtaacc tacacgaacc ggctcgcgtt cggcgtagta aggtcacaag
    9401  caattcctcc aagaaaagcg tcgctacaag aaaaccttct gtcgtacgag
    9451  agtcgtaatt acaactttat caagacagaa cggtttgttg gaccaagcga
    9501  atttggtagg gcgatggctg ctgccgttat cgaacgttgt ttcaaaatgg
    9551  aagagatggc taagataagg tgtgatatta tatcccttac cggggctaac
    9601  attttgaaat ggctcgataa gcgcactcct tgtcaaataa aggcagtgca
    9651  ggctgagttg aagcttccct tttcggtgga ggaacaaatt accaactaca
    9701  aactgatggt taaacgtgac gctaaggtaa aacttgatga ttcgagccta
    9751  tctaaacatc ccgctgccca gaacattatg tttcacaaga agtttattaa
    9801  tgccatattt tccccatgtt tcgatgagtt caaaaataga gtgttgtcct
    9851  cacttaatga caatatcgta ttctttactg aaatgacgaa cgctgggtta
    9901  gcggaagttg tcagaagaat cattggtgac gacgacaact tttttgttgg
    9951  ggaagtggat ttcagtaagt tcgataaatc tcaggatctg ttcattaagg
   10001  agtacgaacg tacgttatat tccgagtttg ggtttgatac cgaacttctc
   10051  gatgtatgga tggaaggtga atatcgcgct agggcgacta ctttggatgg
   10101  tcaactgagc ttttcagttg atggtcagcg tcgttctgga ggttcgaata
   10151  cttggattgg gaattctttg gtcactctag gcattctctc gttatattac
   10201  gacgtctcaa agtttgaatt actccttgtt tccggtgacg attctttaat
   10251  ttattcaagt gagaagataa gtaacttttc ttctgaaatt tgcttagaaa
   10301  caggctttga gactaagttt atgtctccga gtgtgccgta tttttgttca
   10351  aagtttgtgg ttcagaccgg taacaaaacc tgttttatac ctgaccctta
   10401  taaattatta gtaaagttgg gggctccaca aaacaagtta accgacgaag
   10451  agttatttga gttgtttacc tcttttaagg acataacaca ggactttggt
   10501  gatcaagtgg ttttggagaa gttgaaattg ctagtcgaag ctaagtatgg
   10551  gtttactagc ggaactacta tgcccgctct gtgtgctata cattgtgtac
   10601  ggtccaatta tttatccttc gagaggttgt ttccttttat taggggttgg
   10651  tatgttgtcg atgctttgaa gcttagacaa ctaaggaagt tcgccaattt
   10701  aatctgtgaa cgcatggttt acgataatcg cgtgggttat ttttcgtact
   10751  ttgacaatcc gttcactaaa cccgacgcta gcgatggtca aatggacgac
   10801  ttgatgacta gttgatcgtt tgttcagttc tcgctgagag ccaacgttgg
   10851  tagttgagtc gagatgtttg cttccgcgag cgaaaaccaa gatttattag
   10901  aagaaaagat atttcgtcgt agaacgtacc atcgtaagta tttcgatgac
   10951  gtggttaggg atttcactat tgatgttggt tatgacgttg atgatcgtga
   11001  ccctacggtg ttggctgact atttctcgtt gtatttcttt ttgcttaaca
   11051  acgataacgt tgggccttta gcggctacaa ttatagtgag cccgccggtt
   11101  agcgggactt ataaaattcg agcgcacgtc gataatcaac caaattgcga
   11151  aggaaacgtg acttacgtta agactgtcga taaaagtcgt tttgcaattc
   11201  tcataaaatc agtcccggct ccaatgagag gttattactc ttttcgggcg
   11251  tttcttaccg ataatgtcac tagcgaacgc agtgaattca tatgcagttt
   11301  tatcggtagc agattccttt gttgttgtac gcaaacgata tccgaaaatt
   11351  tgagtaaggt ttgttcgtcc tctttctctt ttagagcagt ctcaaaaacc
   11401  gcgattaacg agttttctgt tgcgactgat gatgtagaag acgtcaagta
   11451  tgtgagaaaa caagccgagg gtttctcaca ttgcgctgac ccgtaccctc
   11501  ctaggtgtta tcgcggcgct aatttaggag attcttcagg ggttcaaagt
   11551  cgtacaatcg aagaagaagg ttataggacg gacaccgcag gtaacgtcgc
   11601  ggtcactatc ccgaataccc cacttgttag tgctgtctct ccgtatgtcg
   11651  cagaatacaa cgaaaatacg cgttcgcgta tctcgttaat acgccgagtc
   11701  tgttgttacg ccgtttgtgt tttagtggtg tctcttctta taatgagcgg
   11751  tttgttagcc attatattca tatgatttga tgtagtaact tacgaagtac
   11801  aattagctaa aactcgccgt ttgactctgt ttaaacgggt ttcaatggac
   11851  tgtgtgattc agggatttct gacttttcta gttggtatag ctgtgttttc
   11901  ggcctttgcc ggactgatta tcattgttat aacgatttat cggtgtacga
   11951  ctgagcctgt tagaaacacc tctccttacg acactcacgc cactgtctaa
   12001  gcagtatggt actcctgggt ttagactttg gtaccacgtt ttcgacggtg
   12051  gctatggcta cgtcttctga gttagttata ctcaaacaat ctaattcatc
   12101  gtatatacct acgtgtttgt ttctgcatgc agatcctaac agcgtgtctt
   12151  atggttacga tgcggagtat ttagctgctt caagggaacc cggctcgttt
   12201  tacaaagatt tgaaacggtg ggtcggttgc actgagaaga attaccaaag
   12251  ttacttgcac aagttgtcac catcttataa ggtgatagtg aaagagtttg
   12301  gagctaagag tatgccggtt ccatatttat cacctttgaa taatgatctt
   12351  gggctcagcg tcgctttgcc ttcattgatc gctttataca ccaagtccat
   12401  tttgtcggat gcggaaagag tgtttaacgt gagttgtact ggtgttatat
   12451  gttcggtacc tgctggttat aatacattac agcgagcttt tacgcaacaa
   12501  agtgtatcct tgtcgggtta ctcttgtgtg tatattatta acgaaccttc
   12551  tgctgccgct tactccactt tacctaagtt gagttcggca gataagtatt
   12601  tggccgttta cgatttcggc ggtggaacct ttgatgtttc tatagttagc
   12651  gttagattac ccacgttcgc tgttagaagt tcaggtggtg atatgaactt
   12701  aggcggtaga gacattgata gaaaattgtc tgataaaata tatgagttgg
   12751  ctgaatttct accgcaaaaa gagttgaatg tgtctagtct aaaggaagcc
   12801  ttatctcttc aaacggatcc agtcaaatat accgtaacta attatgggat
   12851  tagtgaaact gtatcaatcg accaaacgac tttgagggag atagcttcgg
   12901  tgtttataac tcgaacgata gacatactta cacaagttaa ggttaagtct
   12951  agtatgcccg agtcgcaaag tttgaagcta gtggtagtcg gtggaagctc
   13001  gtacctacca gggttgttgg atactttgga aactgtacct tttgtgtctg
   13051  ggataatacc agtggaagac gcaaggaccg ccgttgctag agggtgcgct
   13101  ttatatagcg agtgcctgga tggtaggtcc aaggccttat taatagattg
   13151  tatcacgcat catttatcag tcacgacatt tagtgcagac tcggttgttg
   13201  ttgctgcggc cggaagtcca attcctttcg aaggagaacg aaaactcacg
   13251  ttacgtaagt gcgttagtac gtctaattat caagcaagga tgttcgaagg
   13301  agattacgaa aaggtttttc gaaatgagcg tatatacgca gcttcggtat
   13351  cattgtttac tttaggagtt aactggcgcg tgcccaacga cgttgagatg
   13401  actctcgtga ccagagtgga ctcaatgggt aaagtggaat tctaccttaa
   13451  aggtccatct ggtgagttag ttaacgtgca aggtacttca cattatgatt
   13501  atgttggtat gcctcatcct actaggaaat tgttgaggct tagcgattac
   13551  aatgtaaact ccgcagcttt agttttagct ttgacgttga ctcgcgagaa
   13601  acgagaaaaa tttcttttgc gaacgttatt tgatgtttta ctagcagact
   13651  tacgaaagac cgcgagctta agcgaatatt ctaagaaata cccgatcact
   13701  cgaaacgacg tcgatgtcgt ctcatcacgt atggggatcg ttgtttcgaa
   13751  agttttacgg ggaagcgatt tggaaagaat acctctctga atcaactcgg
   13801  aatttcgatg agagaaacgt gtcgttggac cacactctga gttcgggtgt
   13851  ggtcgtccgt aggcagagtc ttttgaacgc gcctcgaggg actttcgaga
   13901  acgagttagc actattgcac aattcggtgg taattaatga cttcgttgag
   13951  ttcactggta tgccgttgga ttccttgatg acaggtatcg aggaccgtga
   14001  ggtacctgac gagttaatat ctgttgaccc gcatgaagtt ggatgtaaat
   14051  ttacgttaaa tgacgtggaa tcatatctaa tgagcagggg tgaggattcc
   14101  gctgatgtga cggcagtcga gcactcgtgg tgtttgagta attcttgcgg
   14151  tagattatta agttcgactg agatagaagc ttacaaaacc atggtgttta
   14201  ctaagaattt tgatagtagc gtatctgggg tgactactaa gttagagact
   14251  tatctatcgt actgcatatc gttgtacaag aaacattgta tgaaagacga
   14301  tgattacttt aatctcatct tacctatgtt taattgttta atgaaagtgc
   14351  tagcgtcgct tggtttgttt tacgagaaac atactgacaa tccgctactc
   14401  accggcatgc ttatagagtt ttgcctagaa aataaggtgt attactctac
   14451  ttttaaagta aatttagaca acgttaggtt gtttaagtct aaagtcttac
   14501  ccgtggtgtt aacggtttgg gatatatctg agcctgatga cccagtggat
   14551  gagggggtac taattccttt cgatcctatg gatttcgtac tcgatttacc
   14601  taaattgaat atacacgaca cgatggtggt ggtgggtaat caaatcagac
   14651  ggttagaaca cgtagttgag agcgatgctt tagacgattt atcacaacac
   14701  gttgatgtac gtttagcagc ggccaatccc gatctacgca tcgatctgcg
   14751  ttgggcagga atgtttgtgt attacggtat ttatcggtgt gctgctgata
   14801  gagaggtaga acgaccagcg ttatttagat taccgcagaa attattgaat
   14851  caggatgatg gtgagtcgtg ctcactatgc atgagttccg tcgaagcttt
   14901  atttagtctg gtgcagaagg tgaacaggga cataaacatt aggcgtcagt
   14951  tcatgggacg tcatagtaaa gtggctttgc ggctgtatcg cagcttaggt
   15001  ttgaagtttc caacgatctc ttcagttagg ttaccagctc atcacggtca
   15051  tctatacgtt gatttttata aaagagtgcc tgatgacgct gttaccgccg
   15101  acgaactcga gagtttacgt caattacgtt cgtccgtgga cgtcatgtgt
   15151  aaggacaggg tgtcaatcac acctccacca ttcaatcgac ttagaagagg
   15201  ttcttctaga acattcagag gtcgaggcgc acgcggtgcg agctcgcgtc
   15251  atttgagcag agacgtggca acttccggtt ttaatctacc ctatcatggc
   15301  aggtcataca atacttccta agactgatga taaagaaatg gatccggtga
   15351  gtgccgctgt acccggtaag tacccggatg ttattgaaaa atttgtggca
   15401  aataggtccg tagatgcgtt aatagaaggc gttataagta agttggatac
   15451  caattcgata tacgaagatt ccactgaaaa gtttactggt gagcacttga
   15501  agtacgttat ggttactatg gacattttct tattagaaaa ctataaaacg
   15551  aaaacggaag atctgttagt tcacttagct atgatccaaa agaggttatg
   15601  caccatatcc acgagtacta aaactaaatt ccgcgataag ggttgtatta
   15651  gttacgtaca aggaggttca cgatacaagt tattggataa agtagttttt
   15701  ccttttatta tatcgaaatt taccgacagg gagactccaa atgctctacg
   15751  taagtatgct tgcactttcg aggagttaca cttatgtatg gccaggttaa
   15801  gacccgactt atacgagaat aaaaggacga ccaaggctgg gactccacat
   15851  ttaaaaggtt acttagcagc tgactttctt tcgggttctc tcccagggta
   15901  ctctgagcat gaacgaggca ttattcttcg agcgtccgaa tctatgttag
   15951  ctagacgtca aggttacgag gaggcaaccg agcttcttaa cctacgtgat
   16001  ttgggtaagt acgtgtagtt gattttgggc ggtaatatca taccatccca
   16051  tgagcgctgc tttaagggtc gttaattgac gactcttgat atatttacta
   16101  ggtttgagtt atggacgacg aaacaaagaa actgaagaac aaaaacaagg
   16151  aaacgaaaga aggtgacgat gttgttgcag ctgagtcttc tttcggttcc
   16201  gtaaacttac acatcgatcc gactctgata gcgatgaacg atgtgcgtca
   16251  gttgggtacc caacagaatg ctgctttgaa tagagatttg tttcttacct
   16301  tgaaagggaa gtatcctaac ttacctgaca aagataaaga ctttcacata
   16351  gctatgatgt tatatcgttt agcagttaag agttcttcat tacaaagcga
   16401  cgatgatacc acgggtatga cgtacactcg ggaaggtgtt gaagtggaac
   16451  tgtctgacaa actttggaca gacgttgtgt ttaactctaa gggtattggt
   16501  aaccgtacta acgcacttcg agtttggggt agaactaacg atgcccttta
   16551  tttagctttt tgtagacaga accgcaactt gagttatggt ggacgtccgt
   16601  tagatgcagg aattccagcc gggtatcact acctgtgtgc agatttcttg
   16651  accggggctg gcttgactga tttagaatgt gcagtgtaca tacaagctaa
   16701  agagcaatta ttaaagaagc gaggggctga tgaggtcgta gttactaatg
   16751  tcaggcagct tgggaaattt aacacacgtt gatatattgc gttccgattc
   16801  tcgattcata tcgggatggt ggagtttcgt tgtgaacgta ggcgatataa
   16851  tcgtccggtt tgcgttacac gttcctagcg aagaaatgct gaatgatttt
   16901  tcagctatat cgaattgtac gatcatagcg gacggtagtg ctttactaaa
   16951  agacaacatc gtatttgatc gtttagaagg catgaacccc ttggcttatt
   17001  tgttaaaatt agcaaaaacg actactacta tttgttttac tatgtctaat
   17051  aaggttctct ttggtactac taaatccgaa ccgcttagtt gtttagctat
   17101  tacgtcggat cgagttttat tcaaagttgt tatgggtact aacgttgatg
   17151  acactcgatg cggttgcagt atctggtttt acaacaatgg aatgtttcga
   17201  aacggattga cccgttgtga taatctcgtc actttgttta gtgcgactta
   17251  gacacgaagt ggccgttagg atttaattgc tgcaatgagt attcgacgtg
   17301  tgtggttaaa ggttgtggct gtaattacgg tattatggta cggtaaagaa
   17351  ccttctatta gtgaaggtta caacgctctt atgaatgatg acttcaagtt
   17401  catcgacacg catttttcaa acatttctta tgctaagaaa tgttacgatt
   17451  tggctaattt cgatttagac tttctacgcg tcgttgtcat tcctttaagt
   17501  ggtagtacgg cgaatgaatc gcgtgctgat cgcgctaata tttcagaaat
   17551  tgtcgaatcg catgtaagcg accgagacag aatgaacatt ttgttgcgta
   17601  acaagcggat ccaaatccca tcgctcttac cttgcggtaa ctagagtcta
   17651  ctcagtagta catctactag tataacgtat tgaacacttt agtaaaggat
   17701  tttgtttgga ccaaacaata tgcgagctta ctttagtgtt aacgattaca
   17751  taagcctttt ggctaatgtc ggtgcagctg tggaacgttt gtgcgatccc
   17801  agcgtaactc ttacggaagt gatagacgaa attaatgact tcaactcgtt
   17851  tctcgctttg gtgcactcta tgaagtctga catgaacgga gaccatcagg
   17901  atggccacca tgagatgggt gaacacaagt ctcgattgtt atgcaatata
   17951  gaggcgaaat tgcgagtact tctcgacatt ataaggcgtc ggttcactcg
   18001  cgaaaagctg ctttgtacca gcgcggtaga tgtcatgggc tttttcgtta
   18051  tgaggtacat gagctccagc cacactagct tcgagtctgt aatgagaacg
   18101  gagttgaagt tagtggttaa ggtggtactg tcggatctgt cccgtgcgca
   18151  taagttagat tttagcgagc gagcttttac cgcttacggt atccttttgc
   18201  aaaagggtac tgtgtcgacc gtttgcggtc agtttgacat taatttagtc
   18251  tctccgtctt gcgtgtaggt taatacattt ctcagaacgt gtggttgtat
   18301  taactaactt taattggaac gagtttattg taaagtctgt gagttacaat
   18351  ggacagtact agcggacaaa ctttcgtttc tgtgaacctt tctgacgaaa
   18401  gcaacacagc aagtactgca gttagaaccg taagttcgga agctgatcgc
   18451  ttggaatttt tacgaaaaat gaaccccttt atcatcgacg ctttggtacg
   18501  gaaaaccagt tatcagggtg ctcgctttcg cgcaaaaata ataggagtat
   18551  gcgtagattg tggtagaaaa cacgataagg ggttgaagac cgaacgtaaa
   18601  tgtaaggtca acaatacaca atctcagaac gaggtggcgc atatgttaat
   18651  gcacgatccc gttaagtatt taaatgaagg aaaggctaga gccttttcta
   18701  acgcagagat gtttgcgatc gatttggtta tgtacaccaa ggaaaagcag
   18751  ttggcgatta atctagccgc tgaaagggag aagacgagac tggctcgtag
   18801  acacccgatg cgttctccgg aagaaactcc ggaacactat aaattcggta
   18851  tgactgctaa agcaatgtta ccggacgtca acgctgtgga cgttggtgat
   18901  aacgaggaca cttcgtcgga gtacccagtg agtctgagtg tttctggcgg
   18951  agttctccgt gaacaccact tcgtctgatt gaagtggacg gaataagttc
   19001  cttgcggaac tttatgtcgg gttggtaaaa acccttatga tggtgatata
   19051  tcactagaca ataaccggat gggtaaagtc tttaaaatga tcgtggggaa
   19101  aattaaccgt atcctctcgt tggtctaagc tcccacagag tggtagtggt
   19151  ctcaagtgag gcttaacgta tgcgtgaacc aaagaagttc tccttagaat
   19201  gtgtgttgtt tacccaacac actgtcccta tggggggcca acata