Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CB3 P25 gene, complete cds.

ACC No: GQ475037

Dated: 2009-09-29 | Length: 672 | CRC: -1101752703

                
ID   GQ475037; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   GQ475037;
XX
DT   29-SEP-2009 (Rel. 102, Created)
DT   29-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CB3 P25 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Santos F.A., Souza A.A., Coletta Filho H.D., Natividade Targon M.L.P.,
RA   Peroni L.A., Carvalho D.A., Machado M.A.;
RT   "Evidence of synergism between subisolates of Citrus tristeza virus in
RT   Mexican lime";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Santos F.A., Souza A.A., Coletta Filho H.D., Natividade Targon M.L.P.,
RA   Peroni L.A., Carvalho D.A., Machado M.A.;
RT   ;
RL   Submitted (04-AUG-2009) to the EMBL/GenBank/DDBJ databases.
RL   Centro de Citricultura Sylvio Moreira, Instituto Agronomico, Rod.
RL   Anhanguera km 158, Cordeiropolis, SP 13490-970, Brazil
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis L. Osb."
FT                   /isolate="CB3"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /collection_date="05-May-1998"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="P25"
FT                   /protein_id="ACV92778.1"
FT                   /translation="MDDETPLLRNKNKETKEGDHVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREAVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFSRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 190 A; 133 C; 170 G; 179 T; 0 other;

gq475037 Length: 672  29-SEP-2009  Type: N  Check: 1235  ..

       1  atggacgacg aaacacccct tttgaggaac aaaaacaagg aaacgaaaga
      51  aggcgaccat gttgttgcag cggagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaagtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga cgacgacacc
     301  acgggcataa cgtacactcg ggaggccgtc gaagtggatt tgtccgacaa
     351  actttggact gacgtcgtat ttaattctaa aggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  agtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga cttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga