Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate subisolate1+2 P25 gene, complete cds.

ACC No: GQ475041

Dated: 2009-09-29 | Length: 672 | CRC: 1398756066

                
ID   GQ475041; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   GQ475041;
XX
DT   29-SEP-2009 (Rel. 102, Created)
DT   29-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate subisolate1+2 P25 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Santos F.A., Souza A.A., Coletta Filho H.D., Natividade Targon M.L.P.,
RA   Peroni L.A., Carvalho D.A., Machado M.A.;
RT   "Evidence of synergism between subisolates of Citrus tristeza virus in
RT   Mexican lime";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Santos F.A., Souza A.A., Coletta Filho H.D., Natividade Targon M.L.P.,
RA   Peroni L.A., Carvalho D.A., Machado M.A.;
RT   ;
RL   Submitted (04-AUG-2009) to the EMBL/GenBank/DDBJ databases.
RL   Centro de Citricultura Sylvio Moreira, Instituto Agronomico, Rod.
RL   Anhanguera km 158, Cordeiropolis, SP 13490-970, Brazil
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia (Christm.) Swingle"
FT                   /isolate="subisolate1+2"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /collection_date="25-Oct-2003"
FT                   /note="separated by single aphid transmission; dominant
FT                   form after joining both in a plant"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="P25"
FT                   /protein_id="ACV92782.1"
FT                   /translation="MDDETKKLKNENKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 196 A; 122 C; 172 G; 182 T; 0 other;

gq475041 Length: 672  29-SEP-2009  Type: N  Check: 4524  ..

       1  atggacgacg aaacaaagaa attgaagaac gaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcg ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcccaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtgtga cgtacactcg ggaaggtgtt gaggtggagt tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtact tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga