Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CB104 P25 gene, complete cds.

ACC No: GQ475043

Dated: 2009-09-29 | Length: 672 | CRC: -25539790

                
ID   GQ475043; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   GQ475043;
XX
DT   29-SEP-2009 (Rel. 102, Created)
DT   29-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CB104 P25 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Santos F.A., Souza A.A., Coletta Filho H.D., Natividade Targon M.L.P.,
RA   Peroni L.A., Carvalho D.A., Machado M.A.;
RT   "Evidence of synergism between subisolates of Citrus tristeza virus in
RT   Mexican lime";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Santos F.A., Souza A.A., Coletta Filho H.D., Natividade Targon M.L.P.,
RA   Peroni L.A., Carvalho D.A., Machado M.A.;
RT   ;
RL   Submitted (04-AUG-2009) to the EMBL/GenBank/DDBJ databases.
RL   Centro de Citricultura Sylvio Moreira, Instituto Agronomico, Rod.
RL   Anhanguera km 158, Cordeiropolis, SP 13490-970, Brazil
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis L. Osb."
FT                   /isolate="CB104"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /collection_date="05-May-1998"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="P25"
FT                   /protein_id="ACV92784.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGNQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDGDTTGVT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 199 A; 120 C; 171 G; 182 T; 0 other;

gq475043 Length: 672  29-SEP-2009  Type: N  Check: 4202  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc ttttggttcg ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtaac
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcccaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cggtgatacc
     301  acgggtgtga cgtacactcg ggaaggtgtt gaagtggagt tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccggcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtact tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaagtagta gttaccaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga