Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CB3 P23 gene, complete cds.

ACC No: GQ475046

Dated: 2009-09-29 | Length: 630 | CRC: -749166230

                
ID   GQ475046; SV 1; linear; genomic RNA; STD; VRL; 630 BP.
XX
AC   GQ475046;
XX
DT   29-SEP-2009 (Rel. 102, Created)
DT   29-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CB3 P23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-630
RA   Santos F.A., Souza A.A., Coletta Filho H.D., Natividade Targon M.L.P.,
RA   Peroni L.A., Carvalho D.A., Machado M.A.;
RT   "Evidence of synergism between subisolates of Citrus tristeza virus in
RT   Mexican lime";
RL   Unpublished.
XX
RN   [2]
RP   1-630
RA   Santos F.A., Souza A.A., Coletta Filho H.D., Natividade Targon M.L.P.,
RA   Peroni L.A., Carvalho D.A., Machado M.A.;
RT   ;
RL   Submitted (04-AUG-2009) to the EMBL/GenBank/DDBJ databases.
RL   Centro de Citricultura Sylvio Moreira, Instituto Agronomico, Rod.
RL   Anhanguera km 158, Cordeiropolis, SP 13490-970, Brazil
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .630
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis L. Osb."
FT                   /isolate="CB3"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /collection_date="05-May-1998"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="P23"
FT                   /protein_id="ACV92787.1"
FT                   /translation="MDNTSGQTFISVNLSDESNPASTEIKTVSSEADRLEFLRKMNPFI
FT                   IDALIRKNSYQGARFRARIIGVCVDCGRKHDKASRTERKCRVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVVHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 630 BP; 192 A; 126 C; 159 G; 153 T; 0 other;

gq475046 Length: 630  29-SEP-2009  Type: N  Check: 8013  ..

       1  atggataata ctagcggaca aacttttatt tctgtgaacc tttctgacga
      51  aagcaaccca gctagtactg aaatcaaaac cgtaagttcg gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct tcattatcga cgctttgata
     151  cggaaaaata gttatcaagg cgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgataa ggcatcgagg actgaacgta
     251  agtgtagggt caacaatacg cagtctcaga acgaggtggc gcatatgcta
     301  atgcacgatc ccgtaaaata tttaaataaa agaaaagcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tgtgcacacc aaagaaaggc
     401  aattagcggt tgatttggcc gctgaaaggg agaagacgag attggctcgt
     451  agacacccga tgcgttctcc ggaagagact ccggaacatt ataaattcgg
     501  tatgactgct aaggcaatgt taccggacat caacgctgta gacgttggtg
     551  ataacgaaga cacctcgtcg gagtacccag taagtctgag tgtttccggc
     601  ggagttctcc gtgaacacca cttcatctga