Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate subisolate2 P23 gene, complete cds.

ACC No: GQ475052

Dated: 2009-09-29 | Length: 630 | CRC: -456846486

                
ID   GQ475052; SV 1; linear; genomic RNA; STD; VRL; 630 BP.
XX
AC   GQ475052;
XX
DT   29-SEP-2009 (Rel. 102, Created)
DT   29-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate subisolate2 P23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-630
RA   Santos F.A., Souza A.A., Coletta Filho H.D., Natividade Targon M.L.P.,
RA   Peroni L.A., Carvalho D.A., Machado M.A.;
RT   "Evidence of synergism between subisolates of Citrus tristeza virus in
RT   Mexican lime";
RL   Unpublished.
XX
RN   [2]
RP   1-630
RA   Santos F.A., Souza A.A., Coletta Filho H.D., Natividade Targon M.L.P.,
RA   Peroni L.A., Carvalho D.A., Machado M.A.;
RT   ;
RL   Submitted (04-AUG-2009) to the EMBL/GenBank/DDBJ databases.
RL   Centro de Citricultura Sylvio Moreira, Instituto Agronomico, Rod.
RL   Anhanguera km 158, Cordeiropolis, SP 13490-970, Brazil
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .630
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia (Christm.) Swingle"
FT                   /isolate="subisolate2"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /collection_date="25-Oct-2003"
FT                   /note="separated by single aphid transmission"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="P23"
FT                   /protein_id="ACV92793.1"
FT                   /translation="MDNTSGQTFVSVNLSDESNTASTAVRTVSSEADRLEFLRKMNPFI
FT                   IDALVRKTNYQGARFRAKIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKGKARAFSNAEMFAIDLVMYTKEKQLAVNLAAEREKTRLARRHPMRSPEETPEF
FT                   YKFGITAKAMLPNINAVDVGDNEDTSSEYPVSLSVSDGVLREHHFI"
XX
SQ   Sequence 630 BP; 194 A; 122 C; 155 G; 159 T; 0 other;

gq475052 Length: 630  29-SEP-2009  Type: N  Check: 815  ..

       1  atggataata ctagcggaca aactttcgtt tctgtgaacc tttctgacga
      51  aagcaacaca gcaagtactg cagttagaac cgtaagttcg gaagctgatc
     101  gcttggaatt tttacgaaaa atgaacccct ttatcatcga cgctttggta
     151  cggaaaacca attatcaggg tgctcgcttt cgcgcaaaaa taataggagt
     201  atgcgtagat tgtggtagaa aacacgataa ggggttgaag accgaacgta
     251  aatgtaaggt caataataca cagtctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgttaagta tttaaataaa ggaaaggcta gagctttttc
     351  taacgcagag atgtttgcaa tcgatttggt tatgtacacc aaggaaaagc
     401  agttggcggt taatttggcc gctgaaaggg agaagacgag actggctcgt
     451  agacacccga tgcgttctcc ggaagaaact ccggaattct ataaattcgg
     501  tataactgct aaagcaatgt taccgaacat caacgctgtg gacgttggtg
     551  ataacgagga cacttcgtcg gagtacccag tgagtctgag tgtttctgac
     601  ggagttctcc gtgaacacca cttcatctga