Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CB2 P27 gene, complete cds.

ACC No: GQ475054

Dated: 2009-09-29 | Length: 726 | CRC: -1145102103

                
ID   GQ475054; SV 1; linear; genomic RNA; STD; VRL; 726 BP.
XX
AC   GQ475054;
XX
DT   29-SEP-2009 (Rel. 102, Created)
DT   29-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CB2 P27 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-726
RA   Santos F.A., Souza A.A., Coletta Filho H.D., Natividade Targon M.L.P.,
RA   Peroni L.A., Carvalho D.A., Machado M.A.;
RT   "Evidence of synergism between subisolates of Citrus tristeza virus in
RT   Mexican lime";
RL   Unpublished.
XX
RN   [2]
RP   1-726
RA   Santos F.A., Souza A.A., Coletta Filho H.D., Natividade Targon M.L.P.,
RA   Peroni L.A., Carvalho D.A., Machado M.A.;
RT   ;
RL   Submitted (04-AUG-2009) to the EMBL/GenBank/DDBJ databases.
RL   Centro de Citricultura Sylvio Moreira, Instituto Agronomico, Rod.
RL   Anhanguera km 158, Cordeiropolis, SP 13490-970, Brazil
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .726
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis L. Osb."
FT                   /isolate="CB2"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /collection_date="05-May-1998"
FT                   /db_xref="taxon:12162"
FT   CDS             4. .726
FT                   /codon_start=1
FT                   /product="P27"
FT                   /protein_id="ACV92795.1"
FT                   /translation="MAGHTILPKIDDKEMDPVSAAVPGKYPDVVEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEYLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGSRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
XX
SQ   Sequence 726 BP; 214 A; 140 C; 173 G; 199 T; 0 other;

gq475054 Length: 726  29-SEP-2009  Type: N  Check: 6940  ..

       1  atcatggcag gtcatacaat acttcctaag atcgacgaca aagaaatgga
      51  tccggtgagt gccgccgtgc ccggtaagta tccggatgtc gttgagaaat
     101  ttgtggccaa taggtccgta gatgcgttaa tagaaggcgt tataagtaag
     151  ttggatacca attcaatata cgaggattcc actgaaaaat ttactggtga
     201  atacttgaaa tacgtcatgg ttactatgga tactttctta ttagaaaact
     251  acaagacgaa aacggaagat ctgttggttc acttagctat gatccaaaag
     301  aggttgtgca ctatatccac gagcactaaa accaagttcc gcgataaagg
     351  ttgtattagt tacgtgcaag ggggttcgcg gtataagtta atggataaag
     401  tagtttttcc tttcattata tcgaaattta ccgataggga gaccccgaac
     451  gctctacgta agtatgcttg cactttcgag gagttacact tatgtatggc
     501  taggttgaga cccgacttat acgaaaataa aaggacgacc aaagccggga
     551  ctccgcattt aaagggctac ttatcagccg actttctttc gggttctctc
     601  ccagggtact cggaacatga gcgaggcatc attcttcgag cgtctgagtc
     651  tatgttagct agacgtcaag gttacgagga ggcaaccgag cttcttaatc
     701  tacgcgattt gggtaagtac ttatag