Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate subisolate1 P27 gene, complete cds.

ACC No: GQ475055

Dated: 2009-09-29 | Length: 720 | CRC: 335508568

                
ID   GQ475055; SV 1; linear; genomic RNA; STD; VRL; 720 BP.
XX
AC   GQ475055;
XX
DT   29-SEP-2009 (Rel. 102, Created)
DT   29-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate subisolate1 P27 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-720
RA   Santos F.A., Souza A.A., Coletta Filho H.D., Natividade Targon M.L.P.,
RA   Peroni L.A., Carvalho D.A., Machado M.A.;
RT   "Evidence of synergism between subisolates of Citrus tristeza virus in
RT   Mexican lime";
RL   Unpublished.
XX
RN   [2]
RP   1-720
RA   Santos F.A., Souza A.A., Coletta Filho H.D., Natividade Targon M.L.P.,
RA   Peroni L.A., Carvalho D.A., Machado M.A.;
RT   ;
RL   Submitted (04-AUG-2009) to the EMBL/GenBank/DDBJ databases.
RL   Centro de Citricultura Sylvio Moreira, Instituto Agronomico, Rod.
RL   Anhanguera km 158, Cordeiropolis, SP 13490-970, Brazil
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .720
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia (Christm.) Swingle"
FT                   /isolate="subisolate1"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /collection_date="25-Oct-2003"
FT                   /note="separated by single aphid transmission"
FT                   /db_xref="taxon:12162"
FT   CDS             4. .720
FT                   /codon_start=1
FT                   /product="P27"
FT                   /protein_id="ACV92796.1"
FT                   /translation="MAALTILPKTDDKEMDPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VIGKLDTNSIYEDSTEKFTGEYLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLLDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTAKAGTPHLKGYLSADFLSGPLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGK"
XX
SQ   Sequence 720 BP; 220 A; 130 C; 163 G; 207 T; 0 other;

gq475055 Length: 720  29-SEP-2009  Type: N  Check: 4309  ..

       1  atcatggcag ctcttacaat acttcctaag actgatgata aagaaatgga
      51  tccggtgagt gccgctgtac ccggtaagta cccggatgtt attgaaaaat
     101  ttgtggcaaa taggtctgta gatgcgttaa tagaaggcgt tataggtaag
     151  ttggatacca attcgatata cgaggattcc actgaaaagt ttactggtga
     201  gtacttaaag tacgttatgg ttactatgga cactttctta ttagaaaact
     251  ataaaacgaa aacggaagat ctgttagttc acttagctat gatccaaaag
     301  aggttatgca ccatatccac gagtactaaa actaagttcc gcgataaggg
     351  ttgtattagt tacgtacaag gaggtttacg atacaaatta ttggataaag
     401  tggtttttcc ttttattata tcgaaattta ccgacaggga gactccgaat
     451  gctctacgta agtatgcttg cactttcgag gagttacact tatgtatggc
     501  tagattaaga cccgacctat acgagaataa aaggacggcc aaggctggga
     551  ctccacattt aaaaggttac ttatcagctg actttctttc gggtcctctc
     601  ccagggtact ctgagcatga acgaggcata attcttcgag cgtccgaatc
     651  tatgttagct agacgtcaag gttacgagga ggcaaccgag cttcttaacc
     701  tacgtgattt gggtaagtaa