Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate subisolate2 P27 gene, partial cds.

ACC No: GQ475056

Dated: 2009-09-29 | Length: 724 | CRC: -271492765

                
ID   GQ475056; SV 1; linear; genomic RNA; STD; VRL; 724 BP.
XX
AC   GQ475056;
XX
DT   29-SEP-2009 (Rel. 102, Created)
DT   29-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate subisolate2 P27 gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-724
RA   Santos F.A., Souza A.A., Coletta Filho H.D., Natividade Targon M.L.P.,
RA   Peroni L.A., Carvalho D.A., Machado M.A.;
RT   "Evidence of synergism between subisolates of Citrus tristeza virus in
RT   Mexican lime";
RL   Unpublished.
XX
RN   [2]
RP   1-724
RA   Santos F.A., Souza A.A., Coletta Filho H.D., Natividade Targon M.L.P.,
RA   Peroni L.A., Carvalho D.A., Machado M.A.;
RT   ;
RL   Submitted (04-AUG-2009) to the EMBL/GenBank/DDBJ databases.
RL   Centro de Citricultura Sylvio Moreira, Instituto Agronomico, Rod.
RL   Anhanguera km 158, Cordeiropolis, SP 13490-970, Brazil
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .724
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia (Christm.) Swingle"
FT                   /isolate="subisolate2"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /collection_date="25-Oct-2003"
FT                   /note="separated by single aphid transmission"
FT                   /db_xref="taxon:12162"
FT   CDS             4. .>724
FT                   /codon_start=1
FT                   /product="P27"
FT                   /protein_id="ACV92797.1"
FT                   /translation="MAPFTILPKTDDKEMDPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEYLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLLDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
XX
SQ   Sequence 724 BP; 221 A; 130 C; 160 G; 213 T; 0 other;

gq475056 Length: 724  29-SEP-2009  Type: N  Check: 6903  ..

       1  atcatggcac cttttacaat acttcctaag actgatgata aagaaatgga
      51  tccggtgagt gccgctgtac ccggtaagta cccggatgtt attgaaaaat
     101  ttgtggcaaa taggtctgta gatgcgttaa tagaaggcgt tataagtaag
     151  ttggatacca attcgatata cgaggattcc actgaaaagt ttactggtga
     201  gtacttaaag tacgttatgg ttactatgga cactttctta ttagaaaact
     251  ataaaacgaa aacggaagat ctgttagttc acttagctat gatccaaaag
     301  aggttatgca ccatatccac gagtactaaa actaagttcc gcgataaggg
     351  ttgtattagt tacgtacaag gaggtttacg atacaaatta ttggataaag
     401  tggtttttcc ttttattata tcgaaattta ccgacaggga gactccgaat
     451  gctctacgta agtatgcttg cactttcgag gagttacact tatgtatggc
     501  tagattaaga cccgacctat acgagaataa aaggacgacc aaggctggga
     551  ctccacattt aaaaggttac ttatcagctg actttctttc gggttctctc
     601  ccagggtact ctgagcatga acgaggcatt attcttcgag cgtccgaatc
     651  tatgttagct agacgtcaag gttacgagga ggcaaccgag cttcttaacc
     701  tacgtgattt gggtaagtac ttat