Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CTV-D5 coat protein gene, complete cds.

ACC No: GQ475538

Dated: 2012-08-02 | Length: 672 | CRC: 1298197074

                
ID   GQ475538; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   GQ475538;
XX
DT   19-OCT-2009 (Rel. 102, Created)
DT   02-AUG-2012 (Rel. 113, Last updated, Version 3)
XX
DE   Citrus tristeza virus isolate CTV-D5 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 22562224.
RA   Biswas K.K., Tarafdar A., Diwedi S., Lee R.F.;
RT   "Distribution, genetic diversity and recombination analysis of Citrus
RT   tristeza virus of India";
RL   Virus Genes 45(1):139-148(2012).
XX
RN   [2]
RP   1-672
RA   Biswas K.K., Tarafdar A., Kumari S.;
RT   "Molecular characterization of Citrus tristeza virus isolates from India";
RL   Unpublished.
XX
RN   [3]
RP   1-672
RA   Kumari S., Biswas K.K., Tarafdar A.;
RT   ;
RL   Submitted (28-JUL-2009) to the INSDC.
RL   Division of Plant Pathology, Indian Agricultural Research Institute, New
RL   Delhi, Delhi 110012, India
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /isolate="CTV-D5"
FT                   /mol_type="genomic RNA"
FT                   /country="India"
FT                   /collected_by="Kajal K Biswas"
FT                   /collection_date="2008"
FT                   /identified_by="Kajal K Biswas"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:D0EDG2"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:D0EDG2"
FT                   /protein_id="ACX55588.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSINLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 197 A; 129 C; 167 G; 179 T; 0 other;

gq475538 Length: 672  02-AUG-2012  Type: N  Check: 9711  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggtgacgat gttgttgccg ctgagtcttc tttcggttcc ataaacttac
     101  acatcgatcc aactctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gtatcctaac ttacctgaca aagataagga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tacaaagcga tgacgacact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatc tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgtacca
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga