Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CTV-D8 coat protein gene, complete cds.

ACC No: GQ475539

Dated: 2012-08-02 | Length: 672 | CRC: -1944658717

                
ID   GQ475539; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   GQ475539;
XX
DT   19-OCT-2009 (Rel. 102, Created)
DT   02-AUG-2012 (Rel. 113, Last updated, Version 3)
XX
DE   Citrus tristeza virus isolate CTV-D8 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 22562224.
RA   Biswas K.K., Tarafdar A., Diwedi S., Lee R.F.;
RT   "Distribution, genetic diversity and recombination analysis of Citrus
RT   tristeza virus of India";
RL   Virus Genes 45(1):139-148(2012).
XX
RN   [2]
RP   1-672
RA   Biswas K.K., Tarafdar A., Kumari S.;
RT   "Molecular characterization of Citrus tristeza virus isolates from India";
RL   Unpublished.
XX
RN   [3]
RP   1-672
RA   Kumari S., Biswas K.K., Tarafdar A.;
RT   ;
RL   Submitted (28-JUL-2009) to the INSDC.
RL   Division of Plant Pathology, Indian Agricultural Research Institute, New
RL   Delhi, Delhi 110012, India
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /isolate="CTV-D8"
FT                   /mol_type="genomic RNA"
FT                   /country="India"
FT                   /collected_by="Kajal K Biswas"
FT                   /collection_date="2008"
FT                   /identified_by="Kajal K Biswas"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q8JYU9"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q8JYU9"
FT                   /protein_id="ACX55589.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPSLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 190 A; 121 C; 178 G; 183 T; 0 other;

gq475539 Length: 672  02-AUG-2012  Type: N  Check: 4577  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc gtgaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgggaacc
     151  caacagaacg ccgctttgaa cagagatttg tttcttactc tgaaagggaa
     201  gtatcctagc ttgtctgaca aggataagga cttccacata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcgt tgcaaagtga tgatgacacc
     301  acgggcataa catatactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  gctttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  atgcccttcg ggtctggggt aggactaacg atgcccttta tttagctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggct ggatatcatt acctatgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa ggaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga