Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate K20 coat protein gene, complete cds.

ACC No: GQ475550

Dated: 2012-08-02 | Length: 672 | CRC: 2113990562

                
ID   GQ475550; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   GQ475550;
XX
DT   19-OCT-2009 (Rel. 102, Created)
DT   02-AUG-2012 (Rel. 113, Last updated, Version 3)
XX
DE   Citrus tristeza virus isolate K20 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 22562224.
RA   Biswas K.K., Tarafdar A., Diwedi S., Lee R.F.;
RT   "Distribution, genetic diversity and recombination analysis of Citrus
RT   tristeza virus of India";
RL   Virus Genes 45(1):139-148(2012).
XX
RN   [2]
RP   1-672
RA   Biswas K.K., Tarafdar A., Kumari S.;
RT   "Molecular variability in CTV isolates from Darjeeling Hills of
RT   Northeastern Himalayan region of India";
RL   Unpublished.
XX
RN   [3]
RP   1-672
RA   Tarafdar A., Biswas K.K., Kumari S.;
RT   ;
RL   Submitted (03-AUG-2009) to the INSDC.
RL   Division of Plant Pathology, Indian Agricultural Research Institute, New
RL   Delhi, Delhi 110012, India
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia"
FT                   /isolate="K20"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Darjeeling Hills of West Bengal"
FT                   /collected_by="Kajal K Biswas"
FT                   /collection_date="2007"
FT                   /identified_by="Kajal K Biswas"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:D0EDH4"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:D0EDH4"
FT                   /protein_id="ACX55600.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVAAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTRDGVEVDLSDKLWTDVVFNSKGIGNRANALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVHIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 194 A; 126 C; 173 G; 179 T; 0 other;

gq475550 Length: 672  02-AUG-2012  Type: N  Check: 3368  ..

       1  atggacgacg aaacaaagaa actgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgctgcag ctgagtcttc tttcggttcc gtaaatttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa cagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgaca aagacaaaga ctttcatata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcat tacaaagcga cgatgacacc
     301  acgggtgtaa cgtacactcg ggacggtgtt gaagtggatt tgtctgacaa
     351  gctttggact gacgtagtgt ttaactctaa gggtattggt aaccgcgcta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaattt gagttatggt ggacgtccgt tagatgcggg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttggaatgt gcagtgcaca tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga