Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate K27 coat protein gene, complete cds.

ACC No: GQ475554

Dated: 2012-08-02 | Length: 672 | CRC: -1457974818

                
ID   GQ475554; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   GQ475554;
XX
DT   19-OCT-2009 (Rel. 102, Created)
DT   02-AUG-2012 (Rel. 113, Last updated, Version 3)
XX
DE   Citrus tristeza virus isolate K27 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 22562224.
RA   Biswas K.K., Tarafdar A., Diwedi S., Lee R.F.;
RT   "Distribution, genetic diversity and recombination analysis of Citrus
RT   tristeza virus of India";
RL   Virus Genes 45(1):139-148(2012).
XX
RN   [2]
RP   1-672
RA   Biswas K.K., Tarafdar A., Kumari S.;
RT   "Molecular variability in CTV isolates from Darjeeling Hills of
RT   Northeastern Himalayan region of India";
RL   Unpublished.
XX
RN   [3]
RP   1-672
RA   Tarafdar A., Biswas K.K., Kumari S.;
RT   ;
RL   Submitted (03-AUG-2009) to the INSDC.
RL   Division of Plant Pathology, Indian Agricultural Research Institute, New
RL   Delhi, Delhi 110012, India
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata"
FT                   /isolate="K27"
FT                   /mol_type="genomic RNA"
FT                   /country="India"
FT                   /collected_by="Kajal K Biswas"
FT                   /collection_date="2007"
FT                   /identified_by="Kajal K Biswas"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:D0EDH8"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:D0EDH8"
FT                   /protein_id="ACX55604.1"
FT                   /translation="MDDETKKLKNKNKEAKDGDDVVAAESSFGSITLHIDPTLIGINNV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRANALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPGRGHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 189 A; 119 C; 178 G; 186 T; 0 other;

gq475554 Length: 672  02-AUG-2012  Type: N  Check: 7804  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aagcgaaaga
      51  tggcgacgat gttgttgcag cggagtcttc tttcggttct ataactttac
     101  acatcgatcc gactctgata ggaataaaca atgtgcgtca gttgggtacc
     151  caacaaaatg ccgctttgaa cagagatttg tttcttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aggataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacact
     301  acgggtataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aatcgtgcta
     401  acgcccttcg agtctggggt aggactaacg atgccctcta tttagctttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccgggc cggggtcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagagtgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga