Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Ak1 coat protein gene, complete cds.

ACC No: GQ475563

Dated: 2012-08-02 | Length: 672 | CRC: -200530346

                
ID   GQ475563; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   GQ475563;
XX
DT   19-OCT-2009 (Rel. 102, Created)
DT   02-AUG-2012 (Rel. 113, Last updated, Version 3)
XX
DE   Citrus tristeza virus isolate Ak1 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 22562224.
RA   Biswas K.K., Tarafdar A., Diwedi S., Lee R.F.;
RT   "Distribution, genetic diversity and recombination analysis of Citrus
RT   tristeza virus of India";
RL   Virus Genes 45(1):139-148(2012).
XX
RN   [2]
RP   1-672
RA   Biswas K.K., Tarafdar A., Kumari S.;
RT   "Molecular variability in CTV isolates from central region of India";
RL   Unpublished.
XX
RN   [3]
RP   1-672
RA   Kumari S., Tarafdar A., Biswas K.K.;
RT   ;
RL   Submitted (04-AUG-2009) to the INSDC.
RL   Division of Plant Pathology, Indian Agricultural Research Institute, New
RL   Delhi, Delhi 110012, India
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia (Tahiti Saisarbati acid lime)"
FT                   /isolate="Ak1"
FT                   /mol_type="genomic RNA"
FT                   /country="India:PDKV farm of Akola Maharashtra"
FT                   /collected_by="Kajal K Biswas"
FT                   /collection_date="2007"
FT                   /identified_by="Kajal K Biswas"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:D0EDH6"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:D0EDH6"
FT                   /protein_id="ACX55613.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGMT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 124 C; 171 G; 179 T; 0 other;

gq475563 Length: 672  02-AUG-2012  Type: N  Check: 2964  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcgtcgt tacaaagcga cgatgatacc
     301  acgggtatga cgtacactcg ggaaggtgtt gaagtggaac tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agatctaacg acgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtaca tacaagctaa agagcaatta
     601  ttgaaaaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga