Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate P2 coat protein gene, complete cds.

ACC No: GQ475564

Dated: 2012-08-02 | Length: 672 | CRC: -321208964

                
ID   GQ475564; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   GQ475564;
XX
DT   19-OCT-2009 (Rel. 102, Created)
DT   02-AUG-2012 (Rel. 113, Last updated, Version 3)
XX
DE   Citrus tristeza virus isolate P2 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 22562224.
RA   Biswas K.K., Tarafdar A., Diwedi S., Lee R.F.;
RT   "Distribution, genetic diversity and recombination analysis of Citrus
RT   tristeza virus of India";
RL   Virus Genes 45(1):139-148(2012).
XX
RN   [2]
RP   1-672
RA   Biswas K.K., Kumari S., Tarafdar A.;
RT   "Molecular variability in CTV isolates from central region of India";
RL   Unpublished.
XX
RN   [3]
RP   1-672
RA   Kumari S., Biswas K.K., Tarafdar A.;
RT   ;
RL   Submitted (04-AUG-2009) to the INSDC.
RL   Division of Plant Pathology, Indian Agricultural Research Institute, New
RL   Delhi, Delhi 110012, India
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia"
FT                   /isolate="P2"
FT                   /mol_type="genomic RNA"
FT                   /country="India:IARI regional research station farm, Pune,
FT                   Maharashtra"
FT                   /collected_by="Kajal K Biswas"
FT                   /collection_date="2007"
FT                   /identified_by="Kajal K Biswas"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:D0EDH6"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:D0EDH6"
FT                   /protein_id="ACX55614.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGMT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 123 C; 170 G; 181 T; 0 other;

gq475564 Length: 672  02-AUG-2012  Type: N  Check: 4008  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatctt tacaaagcga cgatgatacc
     301  acgggtatga cgtacactcg ggaaggtgtt gaagtggaac tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agatctaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc ggatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtaca tacaagctaa agagcaatta
     601  ttgaaaaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga