Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate P10 coat protein gene, complete cds.

ACC No: GQ475568

Dated: 2012-08-02 | Length: 672 | CRC: 140056139

                
ID   GQ475568; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   GQ475568;
XX
DT   19-OCT-2009 (Rel. 102, Created)
DT   02-AUG-2012 (Rel. 113, Last updated, Version 3)
XX
DE   Citrus tristeza virus isolate P10 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 22562224.
RA   Biswas K.K., Tarafdar A., Diwedi S., Lee R.F.;
RT   "Distribution, genetic diversity and recombination analysis of Citrus
RT   tristeza virus of India";
RL   Virus Genes 45(1):139-148(2012).
XX
RN   [2]
RP   1-672
RA   Biswas K.K., Kumari S., Tarafdar A.;
RT   "Molecular variability in CTV isolates from central region of India";
RL   Unpublished.
XX
RN   [3]
RP   1-672
RA   Biswas K.K., Kumari S., Tarafdar A.;
RT   ;
RL   Submitted (04-AUG-2009) to the INSDC.
RL   Division of Plant Pathology, Indian Agricultural Research Institute, New
RL   Delhi, Delhi 110012, India
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata (Nagpur mandarin)"
FT                   /isolate="P10"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Katol, Maharashtra"
FT                   /collected_by="Kajal K Biswas"
FT                   /collection_date="2007"
FT                   /identified_by="Kajal K Biswas"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:D0EDJ2"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:D0EDJ2"
FT                   /protein_id="ACX55618.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 196 A; 128 C; 169 G; 179 T; 0 other;

gq475568 Length: 672  02-AUG-2012  Type: N  Check: 997  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgctg ccgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactttgata acgatgaacg atgtgcgtca gttgggcacc
     151  caacagaacg ctgctttgaa cagagactta ttccttactt tgaaagggaa
     201  gtatcctaac ttacctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgacgcc
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgcctgataa
     351  actttggacc gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgcagacaga atcgcaattt gagttacggc ggacgtccgc tagacgcagg
     501  gattccggcc gggtaccatt acttgtgtgc agatttcttg actggagctg
     551  gtttgactga cttagaatgt gctgtgtaca tacaagctaa agaacaatta
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga