Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate IT08-2 clone 1a coat protein (CP) gene, complete cds.

ACC No: GQ981584

Dated: 2009-11-30 | Length: 672 | CRC: 576925377

                
ID   GQ981584; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   GQ981584;
XX
DT   30-NOV-2009 (Rel. 103, Created)
DT   30-NOV-2009 (Rel. 103, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate IT08-2 clone 1a coat protein (CP) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Saponari M.;
RT   "Low genetic complexity in the Citrus tristeza virus population spreading
RT   in Apulia";
RL   J. Plant Pathol. 0:0-0(2010).
XX
RN   [2]
RP   1-672
RA   Saponari M.;
RT   ;
RL   Submitted (21-SEP-2009) to the EMBL/GenBank/DDBJ databases.
RL   Institute of Plant Virology, CNR, Via Amendola, 165/a, Bari, BA 70126,
RL   Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="IT08-2"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy"
FT                   /clone="1a"
FT                   /note="genotype: T30-like"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /note="P25"
FT                   /protein_id="ACZ52954.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 196 A; 123 C; 170 G; 183 T; 0 other;

gq981584 Length: 672  30-NOV-2009  Type: N  Check: 4068  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgtcgctg ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgagtact
     151  caacagaatg ctgctttgaa cagggactta tttcttgctc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataagga ctttcacata gctatgatgt
     251  tataccgttt agcggttaag agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc gacatcgtgt ataattctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgctcttta cttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccgc tagatgctgg
     501  gattccggct gggtatcatt atttgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga