Sequence of DPV Grapevine associated totivirus-1

Grapevine associated totivirus-1 isolate Ctg412 hypothetical protein gene, complete cds.

ACC No: GU108585

Dated: 2011-03-04 | Length: 4218 | CRC: 829703507

                
ID   GU108585; SV 1; linear; genomic RNA; STD; VRL; 4218 BP.
XX
AC   GU108585;
XX
DT   31-DEC-2010 (Rel. 107, Created)
DT   04-MAR-2011 (Rel. 108, Last updated, Version 3)
XX
DE   Grapevine associated totivirus-1 isolate Ctg412 hypothetical protein gene,
DE   complete cds.
XX
KW   GDS.
XX
OS   Grapevine associated totivirus-1
OC   Viruses; dsRNA viruses; Totiviridae; Totivirus.
XX
RN   [1]
RP   1-4218
RX   PUBMED; 21140178.
RA   Al Rwahnih M., Daubert S., Urbez-Torres J.R., Cordero F., Rowhani A.;
RT   "Deep sequencing evidence from single grapevine plants reveals a virome
RT   dominated by mycoviruses";
RL   Arch. Virol. 156(3):397-403(2011).
XX
RN   [2]
RP   1-4218
RA   Al Rwahnih M., Daubert S., Golino D., Rowhani A.;
RT   ;
RL   Submitted (14-OCT-2009) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Pathology, University of California, Davis, One Shields
RL   Avenue, Davis, CA 95616, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4218
FT                   /organism="Grapevine associated totivirus-1"
FT                   /host="Vitis vinifera cv. Syrah"
FT                   /isolate="Ctg412"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="10-Jun-2008"
FT                   /db_xref="taxon:908836"
FT   CDS             91. .2643
FT                   /codon_start=1
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7BMW7"
FT                   /protein_id="ADO60923.1"
FT                   /translation="MRNVITLLCATSMLGEFKKSGRRGNTCSVTLSKPLLSTSHLVETG
FT                   VVANPTQRNYDVAQAVMTKKIEVADTNMDRRVILQGKTKYMSAALRLAYSSNNKLWKSI
FT                   MGDLMPPISMGEPSDYKSLMRNAVCEVDMTKAELCVLVAEAAAACAKVAGMSDEAAIEN
FT                   LQPMFAVCDNMSRVLTCAMKPSISARDVTSWIARGTLSFEAGFTRLFSIFTRQTDCYKW
FT                   QRRQHVQELYDSDVVGLAMNEEDYSISVGAVLSTNVYGKVSANQVEPSSDNEVTATGHR
FT                   VTDKYGDERPLMKKGLLQTRTALIEDSAVGAATRRTYKNNQTHPTPVYSHSVSTDVNEY
FT                   IEGTATTDGVQLTNVLTARATAGIINATVAWNDTNCMIDGTDRCAVNLTNGFICGPESR
FT                   LTTIATELKRYGFELRLDDSNALGVGNTRREYAFTTNEQQVIAVPMMITGKRLSKEMEQ
FT                   SAFADTLRMLLTRDRASSAIINVYRQMVSVQLAPGIISNPMTWYASRPTATTAVYGLAT
FT                   FKTVLDVPWRQQATIVKSSSLDRPPTQPGGFNKKLLVYKGRAQTYKNEFEEYTFSADFL
FT                   DIGISMYPKLTSLKSTGVTIPQKHLSQLLNEISMRVDEDMNAQYWGVDGLERAIELYRR
FT                   PLGETERASISRTCWHVITGYILTMIKLQVYDTVAKLSSERTPYQRLVAIEANYSTLAM
FT                   NSRYLIAMMVGLDASWANAPSIVHMYYYAKTIQLTNAEMSRVEGNMQYTLSHSYAKVQN
FT                   AYCTTLSGRCMSYCHGMAGTLHKCTRCGKEYECQLCKQSHEVLTGREMTKPTNENVTVT
FT                   LAAAIAGVGCVWCVWEIRYVKNLKLTSLYNESSLLGSK"
XX
SQ   Sequence 4218 BP; 1392 A; 799 C; 1114 G; 913 T; 0 other;

gu108585 Length: 4218  04-MAR-2011  Type: N  Check: 8625  ..

       1  actgtgaata caattcacat ttgtgaacgt gaaaacagag attacgggtt
      51  aaccaactca aaagtattct ctaattcaag tgagagcacg atgcgaaatg
     101  tgatcactct gctgtgtgct acttcaatgt taggcgagtt caaaaagagt
     151  gggcgaagag gcaacacttg ttcagtgaca ctgagcaaac cactactatc
     201  tacgtcacac ttggtggaga caggagtggt cgcgaacccc acccagagga
     251  actatgacgt agcacaagct gttatgacaa agaagataga agttgccgac
     301  actaacatgg acagacgggt gatattacaa gggaaaacta agtacatgag
     351  cgcagctctg cgattagcat actcgagtaa caacaaattg tggaagtcaa
     401  taatgggaga tctaatgcca cccatatcta tgggcgaacc tagtgattac
     451  aaatcattga tgcgcaatgc cgtgtgtgaa gtagatatga ccaaagctga
     501  attgtgcgtg cttgtcgctg aggctgctgc agcatgtgct aaagtagcag
     551  gcatgtctga cgaagcagct attgaaaatt tacaaccgat gttcgccgta
     601  tgtgataata tgagcagagt gctaacttgt gcaatgaaac caagtataag
     651  cgcaagagat gtcactagtt ggatagcgcg aggaactctc tcatttgaag
     701  cagggttcac ccgcctgttt tcaatattta ctagacagac agattgctat
     751  aaatggcaaa ggagacagca tgtacaagaa ctctatgact cagatgtagt
     801  agggttagca atgaatgaag aagactactc aattagcgtg ggcgctgtct
     851  tgagtaccaa tgtatatggg aaggtgtctg ctaatcaagt agaaccatcc
     901  agtgacaacg aagtgacagc aacgggtcac agagtaaccg ataaatatgg
     951  ggatgagaga ccactcatga agaaagggct actgcagaca cggactgcgc
    1001  ttatagagga ttctgcagtt ggagcagcaa ctagaagaac atacaaaaac
    1051  aaccaaacac acccaacacc ggtgtactca cactcagtaa gcactgacgt
    1101  caacgaatac attgagggga cagcgacaac agatggggta cagctgacta
    1151  acgtgttgac agcaagggcg accgcaggca taatcaatgc tacagttgcg
    1201  tggaatgata cgaactgcat gattgatggg acagataggt gtgccgttaa
    1251  tcttacgaac ggattcattt gtgggccgga aagtaggttg acgacaatag
    1301  ctactgagtt aaaacgatat ggtttcgagt tgaggttgga cgacagtaat
    1351  gcactaggtg ttggcaacac taggcgagag tacgctttta cgacaaatga
    1401  acaacaggtc atagcagtac ccatgatgat aaccggaaaa aggttatcta
    1451  aagagatgga acagtcagcg tttgcagaca ctttgaggat gttgttgact
    1501  agggacaggg catcaagtgc aataattaac gtgtataggc aaatggtgtc
    1551  ggtacagctg gcaccaggta taatatcaaa tccaatgacc tggtatgcta
    1601  gtaggccgac agcaacgaca gcagtgtacg gattggcaac gttcaagaca
    1651  gtgctagacg ttccctggcg gcaacaggct actatagtga aaagctcaag
    1701  tctggacaga ccaccaacgc aacctggtgg gtttaacaag aaactgctgg
    1751  tttataaggg aagggcacag acatacaaga atgagtttga ggaatacaca
    1801  tttagtgctg acttcttgga cataggtatt agtatgtacc ctaagttaac
    1851  atcacttaaa agcactggag tgacgattcc acagaagcac ctcagtcaac
    1901  tactaaatga aattagtatg agggttgatg aagacatgaa cgctcaatac
    1951  tggggagtag acgggttaga gcgagcaatt gaactatata gacgccctct
    2001  aggtgaaact gagagagcat ctatatctag gacttgctgg cacgtcataa
    2051  cggggtacat attgacaatg attaagcttc aagtgtatga tacagtagca
    2101  aagttgtcaa gtgagagaac accttaccag agactagtag cgatagaagc
    2151  gaattacagt acactggcaa tgaacagtag gtacttaata gcaatgatgg
    2201  tcgggttaga cgcgagctgg gccaatgcac catctatagt gcacatgtat
    2251  tactacgcta agacaattca attgacgaat gctgagatga gtagagttga
    2301  aggtaatatg caatatacgc tgtcacactc gtatgcgaaa gtgcagaatg
    2351  cgtactgcac aacactgagc ggcaggtgca tgagctactg tcatggtatg
    2401  gcaggtacgc tacacaaatg cactaggtgc ggcaaagagt acgaatgcca
    2451  gctgtgtaaa caatcacatg aagtgctgac aggtagagaa atgactaaac
    2501  caacgaatga aaacgtgacg gtgacgctgg cagcagcgat agcaggtgtt
    2551  gggtgtgttt ggtgtgtttg ggagatacga tacgtgaaga atctgaagct
    2601  aacgagtcta tacaacgagt caagcctact aggcagcaaa taatagcagt
    2651  cgaacttagg ttgaaattaa atagggcctg cgctcaattg cgaccagcta
    2701  taatgcctga gaggtaccat tggttgacaa cggctgacaa gctactgaca
    2751  ccaccagtag aagcagtata tgagagccct ataattgaag tggcgagata
    2801  tgacgagaag aagggagaac aacaggacct attaggaaca gctgatcaag
    2851  ttggaacagg gcagctggaa cagataagta gctacacagg caaaacatgg
    2901  gcagagatgg tacaagaaga tgctgaacaa atggaggtaa gtaatgaaga
    2951  agagaacaag ttagtgccaa caagacaact gacgctacca ccaagccaga
    3001  ttgaagatga tgtagaggac accgagcaca tgatgagtgg tgcactcgat
    3051  ccaccaagtt gcactggcag gagtaatcta ccaccaacat tcacatgtct
    3101  aggaatgcag caatgtgcct atcatgacac gccgatgggt acactggcgt
    3151  gcttgctgtt taatgacaag gatggcaaga tgattgaagc acctaatgac
    3201  cacagtatca ccgaacaaga tcacagagcc atggaagcgg tagactgggc
    3251  agtaaccaaa aaggatcgcg agaacgctga gcttatgaca aagtgtggtg
    3301  tgaagcatga agggactact acccattggt gcgcactagc atcaagacta
    3351  aaagaagatg gcattgggct taaattgcta aaaggcaaaa ccgacgtgaa
    3401  ggtaaccaga ccagagagag attggacaga gaatgaagtg ctagcaacag
    3451  gtggaacaag cagaccgtat tttgacatgt tgaggcattg tccgtgtgag
    3501  gggtgcaagt tctttgctaa ttttgacaac gagaagttga tgtcaagagc
    3551  attgattgac tgtccagtat ggcactatga ttgggcagca ctgaaagaga
    3601  aagagattga ggtggataat agtgcttaca gagcggattg gggctcaaca
    3651  agagtggatg acagatacga tggctcgttg gtagcagtgc tggcatggct
    3701  agcagcaata actggcagac agtacaagtt ggatagagca agaacattac
    3751  tgatgtttgg caatgccaac atatgggcaa accatgccag ttcggacaca
    3801  actgaattgg aaaacggcac aaagtacgca ctacatacgg agtggtcagt
    3851  agtgactaca gaggtggtca atttcgtgca catgttatgt gagtgtaaat
    3901  tcccacacga ccagatgcag atatcatggc catacggacc atattcagca
    3951  atgccaaatg gtgctactct agaggtaagg tatagtacca aagactgtaa
    4001  gatgtccaga atgagcttgc ggcgcatgag cgtgttctat tctatgctgt
    4051  gggaaaatga tgacactgga cgggacgcga aagtgttcct agagatacac
    4101  ggagccatga ttggagacat gaaccactac cacttgcata gggaagtagt
    4151  aagaggacaa ataacagata atataatagt gctagtgatg cagacatgta
    4201  ccaccaacaa gaatggag