Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate F major coat protein (CP25) gene, partial cds.

ACC No: GU266207

Dated: 2010-01-20 | Length: 673 | CRC: 1453951327

                
ID   GU266207; SV 1; linear; genomic RNA; STD; VRL; 673 BP.
XX
AC   GU266207;
XX
DT   20-JAN-2010 (Rel. 103, Created)
DT   20-JAN-2010 (Rel. 103, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate F major coat protein (CP25) gene, partial
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-673
RA   Foroutan A., Rahimian H., Kazemitabar S.K., Mardi M., Ghaffari R.,
RA   Pirseyedi S.M.;
RT   "Quantitative detection of Citrus tristeza virus in different plant tissues
RT   by real-time RT-PCR";
RL   Unpublished.
XX
RN   [2]
RP   1-673
RA   Foroutan A., Rahimian H., Kazemitabar S.K., Mardi M., Ghaffari R.,
RA   Pirseyedi S.M.;
RT   ;
RL   Submitted (04-DEC-2009) to the EMBL/GenBank/DDBJ databases.
RL   Agricultural Biotechnology, Agricultural and Natural Resources University
RL   of Sari, Khazar Abad, Sari, Mazandaran 578, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .673
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia (Mexican lime)"
FT                   /isolate="F"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran"
FT                   /isolation_source="leaf"
FT                   /collection_date="22-Nov-2008"
FT                   /db_xref="taxon:12162"
FT   gene            1. .>673
FT                   /gene="CP25"
FT   CDS             1. .>673
FT                   /codon_start=1
FT                   /gene="CP25"
FT                   /product="major coat protein"
FT                   /protein_id="ADB44906.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKIQH
FT                   TL"
XX
SQ   Sequence 673 BP; 199 A; 128 C; 166 G; 180 T; 0 other;

gu266207 Length: 673  20-JAN-2010  Type: N  Check: 4125  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaataagg aaacgaaaga
      51  aggcgacgat gttgttgccg ctgagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc aactctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gcatcctaac ttacctgaca aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgacact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgt tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaaatt caacacacgt tga