Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate M1S major coat protein (CP25) gene, partial cds.

ACC No: GU266208

Dated: 2010-01-20 | Length: 673 | CRC: -1890847248

                
ID   GU266208; SV 1; linear; genomic RNA; STD; VRL; 673 BP.
XX
AC   GU266208;
XX
DT   20-JAN-2010 (Rel. 103, Created)
DT   20-JAN-2010 (Rel. 103, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate M1S major coat protein (CP25) gene, partial
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-673
RA   Foroutan A., Rahimian H., Kazemitabar S.K., Mardi M., Ghaffari R.,
RA   Pirseyedi S.M.;
RT   "Quantitative detection of Citrus tristeza virus in different plant tissues
RT   by real-time RT-PCR";
RL   Unpublished.
XX
RN   [2]
RP   1-673
RA   Foroutan A., Rahimian H., Kazemitabar S.K., Mardi M., Ghaffari R.,
RA   Pirseyedi S.M.;
RT   ;
RL   Submitted (04-DEC-2009) to the EMBL/GenBank/DDBJ databases.
RL   Agricultural Biotechnology, Agricultural and Natural Resources University
RL   of Sari, Khazar Abad, Sari, Mazandaran 578, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .673
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia (Mexican lime)"
FT                   /isolate="M1S"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran"
FT                   /isolation_source="leaf"
FT                   /collection_date="22-Nov-2008"
FT                   /db_xref="taxon:12162"
FT   gene            1. .>673
FT                   /gene="CP25"
FT   CDS             1. .>673
FT                   /codon_start=1
FT                   /gene="CP25"
FT                   /product="major coat protein"
FT                   /protein_id="ADB44907.1"
FT                   /translation="MDDETKKLKNKNKETREGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   TL"
XX
SQ   Sequence 673 BP; 193 A; 126 C; 175 G; 179 T; 0 other;

gu266208 Length: 673  20-JAN-2010  Type: N  Check: 4519  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgagaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaggtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataaaga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgcacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccagcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttggaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacaccacgt tga