Sequence of DPV Olive latent virus 1

Olive latent virus 1 isolate CM1, complete genome.

ACC No: GU326337

Dated: 2010-04-07 | Length: 3699 | CRC: -660722050

                
ID   GU326337; SV 2; linear; genomic RNA; STD; VRL; 3699 BP.
XX
AC   GU326337;
XX
DT   27-JAN-2010 (Rel. 103, Created)
DT   07-APR-2010 (Rel. 104, Last updated, Version 2)
XX
DE   Olive latent virus 1 isolate CM1, complete genome.
XX
KW   .
XX
OS   Olive latent virus 1
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Necrovirus.
XX
RN   [1]
RP   1-3699
RA   Hasiow-Jaroszewska B., Borodynko N., Pospieszny H.;
RT   "Complete nucleotide sequence of Olive latent virus 1 isolated from
RT   tomato";
RL   Unpublished.
XX
RN   [2]
RP   1-3699
RA   Hasiow-Jaroszewska B., Borodynko N., Pospieszny H.;
RT   "Identification and characterization of Olive latent virus 1 from new host,
RT   Solanum lycopersicum";
RL   Unpublished.
XX
RN   [3]
RP   1-3699
RA   Hasiow-Jaroszewska B., Borodynko N., Pospieszny H.;
RT   ;
RL   Submitted (17-DEC-2009) to the EMBL/GenBank/DDBJ databases.
RL   Virology and Bacteriology, Institute of Plant Protection, National Research
RL   Institute, Wegorka 20, Poznan 60-318, Poland
XX
RN   [4]
RC   Sequence update by submitter
RP   1-3699
RA   Hasiow-Jaroszewska B., Borodynko N., Pospieszny H.;
RT   ;
RL   Submitted (18-MAR-2010) to the EMBL/GenBank/DDBJ databases.
RL   Virology and Bacteriology, Institute of Plant Protection, National Research
RL   Institute, Wegorka 20, Poznan 60-318, Poland
XX
CC   On Apr 5, 2010 this sequence version replaced gi:284182835.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3699
FT                   /organism="Olive latent virus 1"
FT                   /host="Solanum lycopersicum (tomato)"
FT                   /isolate="CM1"
FT                   /mol_type="genomic RNA"
FT                   /country="Poland"
FT                   /db_xref="taxon:47669"
FT   CDS             61. .669
FT                   /codon_start=1
FT                   /product="RdRp/p23"
FT                   /protein_id="ADE48189.1"
FT                   /translation="MELPNQHKQTAAEGFVSFLNWLCNPWRRQRTVNAAVAFQNSVLAI
FT                   EDVEHFEDINECFEESSGGQSQRTKIVAEGAYSPVKSERTRRVRKQKKAKFVKYLVNEA
FT                   RAEFGLPKATEANRLMVQHFLLRRCKDWGVVTSQCHNNVALALTLVFIPTEDDLLARAM
FT                   MNTYKTKSAVRGMDNLQGEGWWNNRLGIGGQVGLAFRAK"
FT   CDS             838. .2235
FT                   /codon_start=1
FT                   /product="RdRp/p52"
FT                   /protein_id="ADE48190.1"
FT                   /translation="MRRGLMERVFYVEGPNGLQDAPKPVRGAFNSLNKFRDLYTKNSWR
FT                   HSPVTNEQFLMNYSGRKLTIYKEAVDSLSHQPLSLRDSRLKTFVKAEKLNLSKKPDPAP
FT                   RVIQPRSPRYNVCLGRYLRHYEHHAFKTIAKCFGEITVFKGFTLEQQGEIMSSKWKKYV
FT                   NPVAVGLDASRFDQHLSVEALQYEHEFYIRDYPNDKQLKWLVNQKLSNIGTAFASDGII
FT                   KYRKEGCRMSGDMNTSLGNCILMCAMVYGLKEHLGINLSLANNGDDCVIVCEKADLKKL
FT                   TSSIEPYFRQFGFKMEVEQPVDIFERIEFCQTQPVFDGYQYIMVRKPSVVTSKDVTSLI
FT                   PCQNQAQYAEWLQAVGECGMSINGGIPVMQNFYHMLQTGVKRTKFTKTGEFQTNGLGYH
FT                   SRYMHRVARAISPETRLSFYLAFGITPDLQEALEVFYDTHTLELDDVVPVDTYQVSGEH
FT                   LINGLPN"
FT   CDS             2219. .2440
FT                   /codon_start=1
FT                   /product="p8"
FT                   /protein_id="ADE48191.1"
FT                   /translation="MDYQTEVSEDNVSVRGRARRGTEDKKHNGSGLTGVKRHAVSETSQ
FT                   KSQQGTGNGTMTNIAEEQTITVTYNFNF"
FT   CDS             2443. .2613
FT                   /codon_start=1
FT                   /product="p6"
FT                   /protein_id="ADE48192.1"
FT                   /translation="MAVCRCCDTSPGITLFPYFAILILILAILVVGTPNQQYHHSPSTY
FT                   EYKTQHISIAK"
FT   CDS             2635. .3447
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADB82659.1"
FT                   /translation="MVNYYWDSRIQRWFYESGPQRVRTYMKADFTPPNGKLPARKTKRS
FT                   PPNRGNLQVLPVAVPTAGGVVSTRRRVPRITTTNEQTVVRNTEVISAINSAALGAFSAN
FT                   TVTVIPTNLSWLAGLSHLYSKYRWRKLRFIYIPICPTSTQGHVSMSLSFDRIDVQPTSI
FT                   IQMQQGYRAITFPPYAGYDGAMALSSFGNIPGMVVVDVDCARMDKLWYPNVTLSTFLAM
FT                   APTSRTDTCGVTLFTASDQGPAAATNFGQVFCQYEIEFIEPVNPTVNV"
XX
SQ   Sequence 3699 BP; 1013 A; 891 C; 897 G; 898 T; 0 other;

gu326337 Length: 3699  07-APR-2010  Type: N  Check: 2360  ..

       1  tagtatacat accaagtata cgatatcggt gcaagcccgt acacagctaa
      51  agtgtctaaa atggagttac ccaaccaaca taagcaaaca gctgctgaag
     101  gtttcgtttc tttccttaac tggctttgta acccctggag acgccaacgt
     151  acagtcaacg ctgctgtcgc ctttcagaat agcgtccttg ctattgagga
     201  cgtagaacac ttcgaagata tcaacgagtg ttttgaggaa tcttctggag
     251  gccaatcgca gcgcactaag attgtcgctg aaggggctta ctctcccgta
     301  aaatccgaac gcacccgccg agtccgcaag caaaagaagg ccaaattcgt
     351  caaatatttg gttaatgagg ctcgtgccga gtttggtctc cccaaagcca
     401  cagaggccaa tcgactcatg gtgcaacact tcctgctccg aaggtgtaag
     451  gattgggggg ttgtcacatc ccagtgccac aacaatgttg cactcgcctt
     501  aactctcgtg ttcatcccaa cagaagatga tttgctggcg cgagctatga
     551  tgaacacgta taagacgaag tctgcggtcc gtgggatgga caacctccaa
     601  ggtgaggggt ggtggaacaa caggcttggc ataggtggcc aggtcggctt
     651  ggcctttcgg gccaagtagg ggtgcctaga gaggaggccg gggttttcca
     701  cgtctgtttc gcgtggaaat caccccgatc tggtggtcaa accatcagga
     751  caccccgaga aacagcgtca gttgttacgc tatagtggaa ttggcggcca
     801  tttattattc ggcatccaca acaactctct ttccaatttg cgtaggggcc
     851  taatggagag agtattctac gtcgaaggac ccaatgggct ccaagacgcc
     901  cctaaacccg ttcggggagc attcaactcc ctgaataagt ttcgagacct
     951  atataccaaa aatagttggc gtcattcccc tgtaaccaat gaacaattct
    1001  tgatgaatta ctcgggcagg aaactgacta tttacaaaga agcggttgat
    1051  agtttgtcgc atcaaccact tagcttacgg gactcgaggc tgaagacgtt
    1101  cgttaaggcc gaaaaactca atctgagcaa aaagccagat ccagcacccc
    1151  gggtcatcca acccaggtca cctcggtaca acgtttgttt gggtcgttat
    1201  ctacgtcact atgaacacca cgcgttcaaa accattgcta aatgctttgg
    1251  ggagatcacg gtctttaaag ggtttactct agagcaacaa ggcgaaatta
    1301  tgtcctcgaa gtggaagaaa tatgttaatc ccgtcgccgt tggactcgac
    1351  gcgagtcggt tcgaccaaca cctgtcagtt gaagcacttc aatatgagca
    1401  tgaattttac attagagatt acccgaatga taaacagcta aaatggttgg
    1451  taaaccaaaa actgagcaat attggcacag cgtttgctag tgatggcatc
    1501  ataaagtata ggaaggaggg ttgtcgtatg agtggagata tgaacaccag
    1551  tttgggcaat tgcattctca tgtgtgcgat ggtctacggg ttgaaggaac
    1601  acctaggcat aaatttatcc cttgccaaca atggggatga ctgcgtcatt
    1651  gtctgtgaga aagcggactt gaagaaattg acaagcagca tcgaaccata
    1701  tttcaggcaa ttcggattca agatggaggt ggaacaaccc gtggacatat
    1751  tcgagcgcat tgagttttgt caaacccaac ctgtgttcga tggctaccaa
    1801  tacatcatgg ttcgaaaacc ctcggtagtt acttctaagg atgtcactag
    1851  cctaatccca tgccagaatc aggctcaata tgcagaatgg ctgcaagctg
    1901  taggtgagtg cggaatgagt atcaatggtg gaatacctgt catgcagaac
    1951  ttttaccata tgctccaaac tggagttaaa cgcaccaaat tcaccaagac
    2001  cggcgagttt cagacgaacg ggttggggta ccactctaga tatatgcata
    2051  gagtggcccg agccatttcg cccgaaaccc gtttatcctt ctatttagcg
    2101  tttggtatca caccagacct ccaggaagca ctggaggtct tctatgatac
    2151  ccatacgctt gagttggatg atgttgtccc agttgatacc taccaagtat
    2201  caggagagca tttgatcaat ggattaccaa actgaggtta gtgaggataa
    2251  cgtgagcgta cgcggtcggg ctaggagggg cactgaggat aagaagcaca
    2301  acggatcggg gttaactggc gttaagcgtc atgcggtgag tgaaacatct
    2351  cagaaatcac agcaaggtac tggtaacggc acaatgacta acatagctga
    2401  agaacagacc attaccgtga catacaactt taacttttag ttatggctgt
    2451  gtgtcgctgt tgtgatactt caccaggtat tacattattc ccttactttg
    2501  ctattctcat tctcatcctt gcaatactcg ttgttggcac tccaaaccag
    2551  caatatcatc attctcctag tacttacgag tataagactc aacacatttc
    2601  gatcgcaaaa tagacatttc gcaactctct caacatggtt aattattact
    2651  gggatagtcg aattcagaga tggttctacg aaagtggacc acagcgtgtc
    2701  cgcacatata tgaaagcgga tttcacccca ccaaacggca aactgcctgc
    2751  tcgcaagact aaaaggtcgc ccccaaatag gggcaaccta caagttcttc
    2801  cggttgcagt accaaccgct ggtggagtgg tctccacaag aagacgcgtt
    2851  cctcgaatta ctactactaa tgagcagact gtcgtgagaa acacagaagt
    2901  cataagtgcc attaactctg ccgctttagg tgcattttcg gcaaacactg
    2951  ttacggtaat cccgaccaat ctctcatggt tggcaggttt atcccatttg
    3001  tacagcaagt accgttggcg caagctccgg tttatctata ttccgatctg
    3051  cccaaccagc acacaaggcc atgtttctat gtcactatca ttcgacagaa
    3101  tcgatgtgca gccaacaagc atcattcaga tgcaacaggg ctaccgtgcc
    3151  atcactttcc cgccttacgc ggggtatgat ggtgccatgg ccttgtcgtc
    3201  attcggcaac attcctggaa tggttgtcgt ggacgtagac tgcgcacgaa
    3251  tggacaagtt gtggtaccct aatgtcacct tgtccacctt tctggccatg
    3301  gcaccaacat ccagaacgga tacctgcgga gtgaccttgt tcactgcaag
    3351  tgatcaaggg ccagccgctg ccaccaactt tggccaagtg ttctgccagt
    3401  acgaaataga atttatagaa ccagtgaacc caactgtcaa tgtgtaacca
    3451  cacaacgatg ggtgagttac gtaactgtgc taatccctaa aggttttagt
    3501  agagcggtaa gcaagccgga tcctgggaga caggtttaac gggctggggg
    3551  tggtgccccg gccgtcgcat cacttgctga tacaatctac aaggcccatg
    3601  ggagggtctg cacaggtatc cacgccaagg acgggacgaa agtctcggac
    3651  ggggggtagt ggacccaaca ccaaattgag gggctcttgc cccacccca