Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate OR-G5b major coat protein gene, complete cds.

ACC No: GU457406

Dated: 2010-06-24 | Length: 597 | CRC: -2086913390

                
ID   GU457406; SV 1; linear; genomic RNA; STD; VRL; 597 BP.
XX
AC   GU457406;
XX
DT   24-JUN-2010 (Rel. 105, Created)
DT   24-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate OR-G5b major coat protein
DE   gene, complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RX   PUBMED; 20528188.
RA   Jarugula S., Alabi O.J., Martin R.R., Naidu R.A.;
RT   "Genetic Variability of Natural Populations of Grapevine
RT   leafroll-associated virus 2 in Pacific Northwest Vineyards";
RL   Phytopathology 100(7):698-707(2010).
XX
RN   [2]
RP   1-597
RA   Jarugula S., Alabi O.J., Martin R.R., Naidu R.A.;
RT   ;
RL   Submitted (12-JAN-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Pathology, Washington State University, Irrigated
RL   Agriculture Research and Extension Center, 24106 North Bunn Road, Prosser,
RL   WA 99350, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /host="Vitis vinifera cv. Pinot Noir"
FT                   /isolate="OR-G5b"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="2007"
FT                   /db_xref="taxon:64003"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /protein_id="ADJ17696.1"
FT                   /translation="MELMSDSNLSNLVITDASSLNGVDKKLLSAEVVKMLVQKGAPNEG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDVIFSNSFGERNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYVDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVV"
XX
SQ   Sequence 597 BP; 162 A; 121 C; 159 G; 155 T; 0 other;

gu457406 Length: 597  24-JUN-2010  Type: N  Check: 518  ..

       1  atggagttga tgtccgacag caaccttagc aacctggtga taaccgacgc
      51  ctctagtcta aatggtgtcg acaagaagct tttatctgct gaagttgtaa
     101  aaatgttggt gcagaaaggg gctcctaacg agggtataga agtggtgttc
     151  ggtctactcc tttacgcact cgcggcaaga accacgtctc ctaaggttca
     201  gcgcgcagat tcagacgtta tattttcaaa tagtttcgga gagaggaatg
     251  tggtagtaac agagggtgac cttaagaagg tactcgacgg gtgtgcgcct
     301  ctcactaggt tcactaataa acttagaacg ttcggtcgta ctttcactga
     351  ggcttacgtt gacttttgta tcgcgtataa gcacaaatta ccccaactca
     401  acgccgcggc ggaattgggg attccagctg aagattcgta cttagctgca
     451  gattttctgg gtacttgccc gaagctctct gaattacagc aaagtaggaa
     501  gatgttcgcg agtatgtacg ctctaaaaac tgaaggtgga gtggtaaata
     551  cgccagtgag caatctgcgt cagctaggta gaagggaagt tgtgtaa