Sequence of DPV Beauveria bassiana RNA virus 1

Beauveria bassiana RNA virus 1, complete genome

ACC No: HE572591

Dated: 2012-11-21 | Length: 5228 | CRC: -1584523784

                
ID   HE572591; SV 1; linear; genomic RNA; STD; VRL; 5228 BP.
XX
AC   HE572591;
XX
DT   30-AUG-2011 (Rel. 109, Created)
DT   21-NOV-2012 (Rel. 114, Last updated, Version 3)
XX
DE   Beauveria bassiana RNA virus 1, complete genome
XX
KW   complete genome.
XX
OS   Beauveria bassiana RNA virus 1
OC   Viruses; dsRNA viruses; Totiviridae; Victorivirus;
OC   unclassified Victorivirus.
XX
RN   [1]
RP   1-5228
RA   Zabalgogeazcoa I.;
RT   ;
RL   Submitted (30-JUN-2011) to the INSDC.
RL   Zabalgogeazcoa I., Abiotic Stress, IRNASA-CSIC, Cordel de Merinas 40-52,
RL   37008 Salamanca, SPAIN.
XX
RN   [2]
RA   Herrero N., Duenas E., Quesada Moraga E., Zabalgogeazcoa I.;
RT   "Prevalence and diversity of viruses in the entomopathogenic fungus
RT   Beauveria bassiana";
RL   Appl. Environ. Microbiol. 78(24):8523-8530(2012).
XX
RN   [3]
RA   Herrero N.;
RT   "Micovirus asociados a los hongos endofiticos y entomopatogenos
RT   Tolypocladium cylindrosporum y beauveria bassiana";
RL   Thesis (2011), Department of Genetics and Microbiology, University of
RL   Salamanca, Salamanca,, Spain.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5228
FT                   /organism="Beauveria bassiana RNA virus 1"
FT                   /isolate="Bb06/02"
FT                   /mol_type="genomic RNA"
FT                   /country="Spain:Fuerteventura"
FT                   /collected_by="Enrique Quesada Moraga"
FT                   /identified_by="Enrique Quesada Moraga"
FT                   /db_xref="taxon:1054649"
FT   CDS             444. .2672
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CCC42234.1"
FT                   /translation="MSTVQTNAFLSGVIANGRGALLTADNQFRRYAANTRSSATIGGNE
FT                   DARLARIFYEVGRVHSTKARALAAAPDGLLRVDAAYPTTGTLAEEFIGLAKKYTNFSAT
FT                   FEYSSLAGIVERIAKGLASQSVFGNVDTGDLAAGRPIIVNALGTFDGPVNSLTNTVFIP
FT                   RLVNSSVTGDVFSVLVHAAAGEGAAIATDLLELDAATRQPILTVVDADGLARACVEALR
FT                   LLGTNMMASNQGPLFALALCRGLHQVVTVVGHTDEGGIVRDLLRHSAFGVPFGGIHFSL
FT                   EPYAGLPALATNSVPDVCSYVDALALSSAALVAHADPGQLYDGRWYPTFYSGTSSDDVE
FT                   VRPGGNLPGTDDMARRNRSQLIGGLSRFSEVYVRGLAQLFACPGDSRVASTFFNSSVAN
FT                   IGVSRHLRYASVAPYFWIEPTSLIPHDFLGTDAEAFGSGALATKDVPRTKGFFEDCWAS
FT                   GVGDAAFSGYHVMLRNPRSAWFFAHWLNHPRNGLGGTQVRQLDPNAIIHPGGHATLPDI
FT                   RDRVEMALPWTDYLWTRGQSPFNAPGEFLNLAGTAGFMVNHYTFDEDGIPQLEHLPTAR
FT                   EFASGEVTISVGRPQGLANGPSNWGDSNARRARTRATRELAASAARVRAFGRPDVAEMP
FT                   ILTTAPQPRGSRVRPEPARANDQAGVGGWRRASNSAGSGEAVPEPFGVPRDVVPQHQAV
FT                   RYPVLARNLGAGGGVAHIPPPNRGPEGGENVDPVAIAGAAPPGGPNPE"
FT   CDS             2672. .5176
FT                   /gene="RdRp"
FT                   /product="RNA directed RNA polymerase"
FT                   /protein_id="CCC42235.1"
FT                   /translation="MATVTSPDTFGKIGIYLSDLLQRYGTNNLPRGGTFVSRLITLQNS
FT                   FSALRHAHPLLPAAANLLLLDFPLQTDIGLHDFIALVREAHSLPPMFDSLCISLFPPQP
FT                   GELVDVTHGRLVRRLVRSSELRDRLFPPKRLIAGETKTNVTLGGCLRSAQRLLGSHKTA
FT                   LIARACIGLPADHLCGVLIFLFCAWRKLGEGALGVALFLSSHPTEGKYASMVLKALGLN
FT                   STDWGALFCETQCLAGRATGTVDVKAEARRRCDPSKLTGELIDVDPDTLRDHVRSILRV
FT                   ELPNGCTVPTLDDFWTSRWLWCVNGSHTGASSDLLGIPRDFLSATHERVYRRAASETVK
FT                   LEPLTSWDGYTSVSASQKLEHGKTRAIFACDTRSYFAFSWVLGSVQKAWRNSRVILDPG
FT                   TGGHLGMAQRIINAQRGGGVNLMLDYDDFNSHHSNGVMAMVFDELCKHVGMPDWYRDVL
FT                   VKSFDRIYYTDNNGRHKIAGTLMSGHRATTFINSVLNAAYIRAAIGSGRFDSLLSLHTG
FT                   DDVYIRCNTLADCAQILEATTAYGCRMNPAKQSIGFRSAEFLRMGIRGDKAYGYLSRSI
FT                   SSLVSGNWSSNDPLAPLESLQTLITGCRAVINRSGVIDVAAFLAPALRYPPQQISNRTL
FT                   IELLRGEVALEGSPVFNTQGRIQNYAAYVPRADELPIPSSWKRHATTDYLSYHVSPIEA
FT                   AALEWSGADAPSLLIASSYSKGLNKVGAAPLPPVSFKRLPVKHARGYVCATDLSKRDVN
FT                   PGVLTKYPVINLVKSRLTTEAILDLLVVELGYRPSGDPREIAFGGEAESKCIFGTLSYP
FT                   DAAAFSKLTTAGNIYTLFSIAM"
XX
SQ   Sequence 5228 BP; 1065 A; 1474 C; 1418 G; 1271 T; 0 other;

he572591 Length: 5228  21-NOV-2012  Type: N  Check: 4470  ..

       1  gaataacaag caccgcagcc tggagtttgt tatactcggc gtaggctccc
      51  ttggacggaa ggccccacca tacggtatgt tggttaatga ccaactgtaa
     101  gaagggtcgt gctgcccccg gcataaacgg ggtcctcatg ggactaattg
     151  tcactatcat tgatccggga tagtagctcg ctgatacatt gctatggtat
     201  agcctttttg gcttcctatg atgtgatgtt ataggacact gtcggccaac
     251  agtggtcaag aatttagtct gtggaccggg tggcaccggt aaaagctatt
     301  caacaccgaa agatgttcgc cctggcttca caggagataa gtgacttggg
     351  gagggttccg ttgatccaag ccatttgttt ccaacgacta tctatctacg
     401  ctttaacaca cacaacctca agtttgtcga atctcatatc gtcatgtcta
     451  ctgtccagac taacgcgttc ctttccggtg tcatagccaa cgggagggga
     501  gccctcttga cggctgacaa ccagttccgc cgttacgcgg cgaacacacg
     551  ctcctccgcc accatcggcg gcaatgaaga cgcacgtctc gcccgtatct
     601  tttatgaggt cggacgggtc cattcaacta aggccagggc tctggctgcg
     651  gcccccgacg gactcctacg agtcgatgca gcttatccaa ccaccggtac
     701  gttggccgag gagttcatcg gtttggcaaa gaagtacacg aacttcagcg
     751  ccacttttga gtattccagt ctggctggca tagttgagcg cattgctaaa
     801  ggactggctt cacagtcagt gtttggtaat gtggacaccg gtgacttagc
     851  ggccggtcgc cccataattg taaatgccct tggtactttc gacggtccag
     901  ttaattctct gaccaacacg gttttcatcc cccgtcttgt taactctagt
     951  gttactggag acgtattttc cgttttggtt cacgccgccg cgggcgaggg
    1001  agctgcgatt gctactgatt tgctcgaact ggatgccgcc accagacagc
    1051  ccattctgac cgtcgtcgac gccgacggtc tcgctcgtgc ttgtgtcgag
    1101  gctctgagat tgctcggcac caacatgatg gccagtaacc aggggcctct
    1151  ctttgcattg gccctttgtc gcggtctgca tcaggttgtc actgttgtgg
    1201  gccacaccga cgaaggaggc attgttcgtg acctcttacg ccacagcgcc
    1251  ttcggggtgc cgttcggggg gatccatttt agcctcgaac cttacgctgg
    1301  cctccctgcc ctcgccacca attctgtccc agatgtttgc tcttacgttg
    1351  acgccctcgc gctctcgagt gcggcacttg tcgcccatgc tgatccagga
    1401  cagctgtatg atggcagatg gtaccccacc ttttacagtg gaacttcttc
    1451  tgacgatgtt gaagttcggc ccggcgggaa cctccctgga accgatgaca
    1501  tggcccgtcg aaacaggagt cagctcatcg gtgggctgtc ccgtttttcc
    1551  gaggtctacg tcagaggttt ggcacagctc tttgcatgtc ctggtgacag
    1601  ccgggtcgcg tccacgttct tcaactcgag cgtggctaac atcggcgtga
    1651  gtcgtcactt gcgatatgca tccgtcgcac catacttctg gatcgagcct
    1701  acgtctttaa tcccccatga ttttttgggt actgacgccg aggcctttgg
    1751  ttccggtgca ctggctacta aggacgttcc aagaactaag gggttctttg
    1801  aggactgttg ggcatccggt gtaggcgacg cagccttctc tgggtatcac
    1851  gtcatgttga ggaaccccag atcggcctgg ttttttgctc actggttgaa
    1901  tcacccgcgc aacggtttgg gtggaacaca ggttcgtcag ttggacccga
    1951  acgcgatcat ccacccaggt ggacatgcca cgttgcctga catcagggac
    2001  cgcgttgaga tggcattgcc atggactgat tacctctgga ctcggggtca
    2051  gtcacccttc aatgctccgg gggaattcct gaatttagcg ggcactgctg
    2101  gtttcatggt gaaccattac actttcgacg aggacggtat ccctcagtta
    2151  gaacacctcc cgacggctag agagttcgcg agcggagagg tgacaatctc
    2201  cgtcggccgt ccgcagggtc tcgctaatgg gccttcgaat tggggtgaca
    2251  gtaacgcacg tcgtgcacgc actcgagcta cgcgcgaact cgccgccagt
    2301  gccgcccgtg tacgggcctt cggacgtcca gatgtcgctg agatgcccat
    2351  cttgacgact gcacctcagc cacgcggctc tagggtgaga ccagagcctg
    2401  cgagagcaaa tgaccaggct ggagtcggcg gttggcgtag ggcttcaaac
    2451  tctgctgggt ccggtgaggc tgtacctgaa ccatttggtg tcccacggga
    2501  tgttgtgcct caacaccagg ctgtccgtta ccctgtattg gctcgcaacc
    2551  taggtgccgg aggtggcgta gcccacattc ctcctccgaa tcgcgggcca
    2601  gaaggtggcg agaatgttga ccctgtcgca attgccggtg ctgccccacc
    2651  cggagggccg aaccccgagt aatggcgacc gtcacttcgc ccgacacctt
    2701  cggaaagatt ggaatatatc tttccgattt actccagcgg tatgggacaa
    2751  ataatctgcc gagaggtgga acgtttgtct caagattgat cactctgcag
    2801  aactcctttt cggcactccg gcacgcgcat cccttgttac cagcggctgc
    2851  aaatttgtta ttacttgatt ttccactcca gactgatatc ggactccacg
    2901  atttcatcgc tctggtacgg gaggcacact cgctgcctcc gatgtttgat
    2951  tctttgtgta tttctctatt tccccctcaa cctggcgagt tggtcgacgt
    3001  cacgcacggt cgcttagtca gaaggcttgt ccggtcgtct gagttgcggg
    3051  accgtctctt tcctccaaag cgtctcatag cgggggaaac taagacgaat
    3101  gtgacgctcg gaggatgtct tagatcggcc caacgactcc tgggctccca
    3151  caagacggcc ctcatcgccc gagcgtgtat cggcttacca gccgatcatc
    3201  tatgcggtgt tctcattttc ttattctgcg cctggcggaa actaggcgaa
    3251  ggagcactcg gtgtggcact cttcttgtcg tcccacccaa ccgagggtaa
    3301  gtacgcgtca atggtgttga aggctcttgg cctcaattct acagattggg
    3351  gtgccctgtt ttgtgaaacc cagtgtttgg ccggacgtgc aacaggaacg
    3401  gttgatgtga aggcggaggc tcgccgtcgc tgtgaccctt caaagttgac
    3451  cggtgagctc attgatgttg acccagacac actgagggac catgtcaggt
    3501  cgatactaag ggttgagctc cctaatgggt gtactgtacc taccctggac
    3551  gatttctgga cctctcgatg gttatggtgc gtcaacgggt ctcacactgg
    3601  cgccagctcc gaccttctcg gcataccccg tgatttcctg tccgcgaccc
    3651  acgagcgggt gtacagacgt gcggcttcgg agaccgtcaa actagagcct
    3701  ctcacgtcct gggacgggta cacctctgtt tccgcgagtc agaagctaga
    3751  acacggtaag acccgtgcaa tcttcgcttg tgacaccagg agttacttcg
    3801  ccttctcgtg ggtcttgggt tctgttcaga aggcctggcg caacagccgg
    3851  gtgatcctag atcccggaac aggaggacac ctgggcatgg ctcagcgcat
    3901  catcaacgct cagcgcggtg gcggagtgaa cctgatgctc gattatgatg
    3951  acttcaattc ccaccattca aacggtgtca tggccatggt tttcgacgaa
    4001  ctctgcaaac acgtcggcat gcccgactgg tatcgggatg tgttagtcaa
    4051  aagctttgac aggatctatt atactgacaa taatggccga cataagattg
    4101  cgggcacctt aatgagcggg caccgagcaa ctacgttcat caacagcgtc
    4151  ctaaacgcgg cctacattcg tgcggccatt ggcagcggcc ggtttgattc
    4201  cctgctctcg ctccacaccg gtgatgatgt gtacatacgg tgtaacaccc
    4251  tggccgactg cgcccaaata ctggaggcca cgaccgccta cggttgtagg
    4301  atgaacccgg caaagcagtc aatcgggttt aggagcgctg agttcttacg
    4351  gatgggtatt cgcggagaca aggcctacgg ctatttgtcc cggtcgatct
    4401  cctcactagt tagtgggaac tggtcctcca atgaccccct cgccccactt
    4451  gagtccctac agaccctcat cacaggctgt agggctgtta taaaccgttc
    4501  gggagtgatt gatgtggcgg ctttccttgc gccggcactt cgttacccgc
    4551  ctcaacaaat ctcaaaccga acacttatcg agctacttcg aggggaagtg
    4601  gctcttgaag gaagcccagt cttcaacacc caaggccgta tacagaatta
    4651  tgctgcgtac gtcccccggg ctgatgagct tcctattccc tcttcatgga
    4701  aaaggcatgc gacgacggat tacttgtcgt accatgtctc cccaattgag
    4751  gcggccgcct tagagtggtc gggagcagac gctccgtccc tacttattgc
    4801  ctctagctat tcaaaagggc taaataaggt cggggcggcg ccgctgcctc
    4851  cggtttcgtt taagcggctg ccggttaagc acgcacgagg gtacgtgtgt
    4901  gccacggatc tatcgaagag ggatgttaac cccggggttt tgaccaagta
    4951  ccccgtaatc aacctagtca agtctcgact gacaaccgag gccatacttg
    5001  atctactggt tgtagaactt ggataccgtc caagtggcga tcctcgtgag
    5051  atcgcctttg gcggcgaagc tgagagcaag tgtatattcg gcacactatc
    5101  ataccccgac gcagcagcgt tttcaaaact taccaccgcc ggtaacatat
    5151  acaccctctt ttcaatagca atgtaagcgg tccagcttcg ggacccatat
    5201  tctgttcgcc ccgtaagggg caaatctc