Sequence of DPV Aspergillus foetidus slow virus 1

Aspergillus foetidus slow virus 1 CP gene and RdRp gene, genomic RNA

ACC No: HE588147

Dated: 2013-01-28 | Length: 5194 | CRC: 112697007

                
ID   HE588147; SV 1; linear; genomic RNA; STD; VRL; 5194 BP.
XX
AC   HE588147;
XX
DT   09-AUG-2012 (Rel. 113, Created)
DT   28-JAN-2013 (Rel. 115, Last updated, Version 2)
XX
DE   Aspergillus foetidus slow virus 1 CP gene and RdRp gene, genomic RNA
XX
KW   .
XX
OS   Aspergillus foetidus slow virus 1
OC   Viruses; unclassified viruses.
XX
RN   [1]
RP   1-5194
RA   Coutts R.;
RT   ;
RL   Submitted (08-SEP-2011) to the INSDC.
RL   Biology, Imperial College, SAF Building, Imperial College Road, SW7 2A7,
RL   UNITED KINGDOM.
XX
RN   [2]
RA   Kozlakidis Z., Herrero N., Coutts R.H.;
RT   "The complete nucleotide sequence of a totivirus from Aspergillus
RT   foetidus";
RL   Arch. Virol. 158(1):263-266(2013).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5194
FT                   /organism="Aspergillus foetidus slow virus 1"
FT                   /host="Aspergillus foetidus IMI 41871"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:1087070"
FT   CDS             374. .2599
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:J3JSF7"
FT                   /db_xref="InterPro:IPR008871"
FT                   /db_xref="UniProtKB/TrEMBL:J3JSF7"
FT                   /protein_id="CCD33023.1"
FT                   /translation="MSTIVRNGYLASVLANPRGTRINGDAQFRRYRANIRTEATVGGVN
FT                   DARHVQVSYEVGRVHRTKGAALAAAADNLVRVEAAYPTADTLVEDFIGLAKKYSNFSAS
FT                   FEYSSLAGVAERLAKGLAASSIWDDMTATDLRGNRVLNISVLGTHDGPVNSLTNAVFIP
FT                   RLVNTAVTGDVFTVMINAVAGEGSAVVTDVLELDAATRQPIVATVDADGFSRACVEALR
FT                   IIGANMLAADQGPLFAYAVTRGIHNVFTVVGHTDEGGVSRDWLRASGFAPPFGGIHYGL
FT                   PVYSGLPALSSTAPADVSAYVDCIALTSAALVAHSDPGITYDDRWYPSFYQGTGADTAE
FT                   VRPGQHQDGTADMGRRNWGQYTSNMPRFLDYYLPGLGKLFGADGSVQLACTVARTHSGL
FT                   MPISRHFNYASIAPFFWIEPTSLIPHDFLGSPAELNGSGSYCTVDVPREKAGFEDITAA
FT                   GAADVAYSAYNVLMRNPRPAWFFAHWLNHPLNGLGAISVRQLDPNGIIHPGACPDHPDV
FT                   RDRVEAALPWTSFMWTRGQSPFPAPGELLNLSGTAGFMVKHLTFDDDAIPTPEHLPTAR
FT                   EFEGVSVRITCGRPMSIANGTSNSPDSTARRARTRAARELAAATARDRLFGRPAVAEMP
FT                   ILTTAPVMRTKVAAPPPQEPPQVSGGVSGWSRAVPAAENGVNDDRNPDGAAVPVVPHYN
FT                   SXKFPVVARPQAGAVIGGGAAPAAPGAPAADEDDNQPPQPVAIGNXN"
FT   CDS             2599. .5118
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="RdRp"
FT                   /product="RNA dependent RNA polymerase"
FT                   /db_xref="GOA:I7HZB6"
FT                   /db_xref="InterPro:IPR001795"
FT                   /db_xref="UniProtKB/TrEMBL:I7HZB6"
FT                   /protein_id="CCD33024.1"
FT                   /translation="MDIQTRISEFGRIGTYLFGLINGTDFMDQINSHGTYVAKLIALRN
FT                   SMSSLRERHALLPAAASLLLLPFPLQVELSIGDVLLLLRSAFNLSYGTTIQAAISSNAI
FT                   PEILSDNLAGRARRIVTLVTQRPDFREKYFPVKKHPGAQTKANVHLAGLVRSAVVLHGR
FT                   GIIGRVLLATAGRLTDDQASSLLIYGSGLLPTFGALGWAIATHMVLYPDDAKALNGALK
FT                   ALGTNSTPYGCLLVEANTLQGRGVGAIDMREKARERCDPDFIQKSVVSANFDELREHVR
FT                   AVITTELSGRDVKMPTLSDFWTSRWAWCVNGSETAKSDEVLGLDPKAYKRTHTRSYRRM
FT                   AAESVRDEPISTWDGTTYASASPKLEAGKTRAIFACDTRSYFAFSWCLNAVQKAWRNSR
FT                   VLLDPGIGGHLGMVNRIRHAQRGGGVNLMLDFDDFNSQHHTVAMQIVFDELCKYIGAPD
FT                   WYRHVLVNSFTRTHVSIDGRWELVQGTLMSGHRGTTFINSVLNAAYIRMAVGGPYFDSL
FT                   LSLHTGDDVYIRANTLGDCDYILNRCRDYGCRLNPAKQSVGYYGAEFLRVAIRGERAYG
FT                   YFARGVSGFVNGNWTSSDPLSLTEGLSSAIASCRTLINRSGDASLADLLGPAIRYRRGL
FT                   TTRQTIQLLRGTLSLEGSPVFNTNYIIRNLRVEGVDKETVPIDNRWKRYATTDYLTDHL
FT                   SPVEVEAIHLAKTDPGPLMIASGYRKGLNLDDKGTPSQVRFRPLPPRLATGFASASQLT
FT                   ARRAEPGCLAKYPVLSLIAGRLTDDELRHLVAMEGGNNTTSDIRKEAFGESPTSKNIIG
FT                   FLSYADAAALSKVTSSGNIFTSISVRV"
XX
SQ   Sequence 5194 BP; 1016 A; 1563 C; 1441 G; 1172 T; 2 other;

he588147 Length: 5194  28-JAN-2013  Type: N  Check: 2850  ..

       1  tgaaacgaaa ggcaactctg accgacgttt cccatcgtgt ctacgagtct
      51  ggcctggaac tacaccccag ctagataggt cggacgcgtg ggtcagagct
     101  ggcttccgtt tctttagcaa acgggcgctt aggcgcgcgt ttccgctggt
     151  acccggaggt ttcaccttcg agttggtacc cccccttggg tagggggttt
     201  gggctgcttc caccctggtt actcacccag taacctagct cgccgccccg
     251  ctgaaaagtg gttaccggag tgaaaaggca ggagttgacg cgctgaggga
     301  gggttccgtt gatctcagcc tagacttctg acggatagca cgctttttac
     351  aaacacttct actcaacgtt gccatgtcta ccatcgtgcg caacggttac
     401  ctggcttcgg tcctggccaa tccccgaggg acccgcatta acggcgacgc
     451  tcagttccgt cgttatcgcg ctaacattag aactgaggct acggtcggcg
     501  gcgtcaacga tgctcggcat gtccaagtgt cgtatgaggt cggccgggtg
     551  caccggacta agggcgccgc actagctgcc gccgcggaca atctcgttag
     601  ggttgaggcg gcttacccca ctgccgatac tctggtggag gattttattg
     651  gcctggctaa aaagtactca aacttctcgg cctcgtttga atactcctcg
     701  ctcgctggtg tcgccgagcg gctcgctaag ggactggccg catcttccat
     751  ctgggatgat atgacagcta ctgacctccg cgggaaccgc gttctcaata
     801  tatctgtcct cggcactcac gacggtccgg tcaattcact gactaacgcc
     851  gtctttatcc cgcgtctcgt caacaccgcc gtgaccggtg acgtttttac
     901  cgttatgatc aatgctgttg cgggcgaggg gtcagccgtc gtaaccgacg
     951  tacttgaatt ggatgcggcc acccggcaac ctatcgttgc tacggtcgac
    1001  gctgacggtt tcagccgcgc gtgtgtcgag gctcttcgca ttattggggc
    1051  caatatgttg gccgcagatc aagggccgct cttcgcctat gctgtaaccc
    1101  ggggcataca caatgttttc accgtcgttg gccacaccga cgagggcggg
    1151  gtcagtcgag actggctccg tgcgtctgga ttcgcgccgc ctttcggtgg
    1201  tatccattac gggctgcctg tctacagcgg gctgccagct ctatcgtcta
    1251  ccgcccctgc cgatgtctct gcctacgttg actgcatcgc tctcacttcg
    1301  gcagccttgg tggcccattc tgatcccggg attacctacg atgaccggtg
    1351  gtacccttct ttttaccagg gtacgggcgc cgataccgcc gaggtacggc
    1401  ccggacagca ccaagatgga accgccgata tgggccggcg caactgggga
    1451  cagtatacct ccaacatgcc tcggttcctt gactattacc ttcctggcct
    1501  gggtaaatta tttggagcag atggctctgt gcaacttgct tgcaccgtcg
    1551  cgcggaccca ctcgggcttg atgccgatca gtaggcactt taattatgcc
    1601  tcaattgccc ctttcttttg gatcgagccg acttctctca tcccccatga
    1651  ctttcttggg agccccgccg aattgaatgg ctctggatca tattgtaccg
    1701  tcgacgtacc gcgcgagaag gcgggttttg aggatattac agcggcaggt
    1751  gccgccgacg ttgcgtactc ggcgtacaac gtcctgatgc gtaaccctcg
    1801  gccggcatgg ttctttgctc actggctgaa ccaccccctc aatggtctcg
    1851  gggccatctc agttagacaa cttgacccta atgggatcat ccaccccggt
    1901  gcgtgccccg accaccccga tgttagagac cgagtcgagg cggccttgcc
    1951  ctggacctcc ttcatgtgga cccgtggcca gtcccctttc cccgcccccg
    2001  gcgagttact caatctcagt gggactgctg gcttcatggt caagcacctg
    2051  acgtttgacg atgacgccat accgaccccc gagcacttgc ctactgcgag
    2101  ggagtttgag ggcgtgtccg ttcgtatcac atgcggacgg cccatgagta
    2151  ttgctaatgg tacgtccaac tcgcctgact ctacggctag acgagctagg
    2201  actcgagccg cacgcgagtt agccgcagcc accgccaggg atcgactctt
    2251  cggtcggccg gcagtagcgg agatgccgat tctcaccacc gctcccgtta
    2301  tgcggacaaa ggtggccgcc cccccacccc aggagccgcc acaggtttcg
    2351  gggggtgtga gtggttggag tcgggccgtc cccgctgctg aaaatggtgt
    2401  caacgacgac aggaatccgg acggtgccgc tgtccccgtt gtaccccact
    2451  ataactcgca naaattcccg gtcgttgccc gcccccaagc tggagccgta
    2501  ataggcggtg gtgctgcccc ggcagccccc ggcgctcctg cagctgatga
    2551  ggatgataac caaccccctc aaccagttgc gatcggtaac nggaattaat
    2601  ggatattcaa actcggatat ctgaattcgg ccggatcggc acatatcttt
    2651  ttggactcat aaacgggact gacttcatgg atcaaatcaa ttctcacggt
    2701  acttacgttg cgaagctcat cgctctccgc aactcaatga gctcgctgcg
    2751  cgagcgtcac gcactccttc ctgctgctgc atctctccta cttttgcctt
    2801  tccctctaca agttgagctt agtattggtg atgttcttct tttattacgt
    2851  tctgctttca atctgtctta cggtacgacc atacaggcgg ccatctcttc
    2901  aaacgccatc ccagagatcc taagcgacaa ccttgctggt agggcgcgcc
    2951  gcatcgtcac acttgtgacg cagcgacctg acttccggga gaaatacttt
    3001  ccggtcaaga aacaccccgg cgctcagact aaggctaatg tacatctggc
    3051  cgggctggtc aggtccgccg ttgtcttaca tgggagaggg attatcggcc
    3101  gggtactact cgccaccgct ggacggttga ctgacgatca ggcatcgtca
    3151  ttgttaattt atggatcggg gcttctacca actttcggag ctctagggtg
    3201  ggcaatcgcc acgcacatgg tcttgtaccc ggacgacgca aaggccctca
    3251  acggtgctct taaggctctg gggactaact ccacccccta cgggtgtctg
    3301  ctggtcgagg cgaataccct acagggacgt ggagtcggtg ccatcgacat
    3351  gcgggaaaaa gcgcgtgaac gttgcgaccc cgacttcatc cagaaatccg
    3401  ttgtctcggc caatttcgac gagttgcgcg agcacgtccg ggccgtaatc
    3451  acgactgaac tctccggtcg tgacgtcaag atgccaactc tgagcgattt
    3501  ctggacctca cggtgggcct ggtgcgtcaa cggttcagag accgcgaagt
    3551  ctgacgaagt tctcggcctc gaccccaagg cgtacaagcg gacgcacacg
    3601  cgctcttacc gccgaatggc tgccgagtcc gtacgggacg agcccatttc
    3651  aacctgggac ggtaccacgt acgcatcggc gtcaccaaaa cttgaggccg
    3701  ggaagacacg tgccatcttc gcgtgcgaca cacggtctta cttcgcgttc
    3751  tcgtggtgtc ttaatgcggt ccagaaggcc tggaggaatt cgcgtgtact
    3801  gttggatccg gggattggtg ggcacctcgg tatggttaac cggatcagac
    3851  acgcccagcg tggtgggggg gtcaacctga tgctcgactt cgacgatttt
    3901  aactcgcagc atcacacggt cgccatgcag atcgtctttg acgaactgtg
    3951  caagtatatc ggcgcccccg actggtaccg gcacgtgctc gtcaattcgt
    4001  tcacgcgcac ccacgtgtct atcgatgggc ggtgggagtt ggtccagggt
    4051  acccttatga gcggccaccg cggcaccacc ttcattaact ccgtcttaaa
    4101  cgcggcctac atccggatgg ccgtcggcgg tccttatttc gacagccttc
    4151  ttagtctcca cactggcgac gacgtctaca tcagggccaa tacccttggt
    4201  gactgtgact acatactgaa tcgctgtcga gattacggct gccggctcaa
    4251  ccctgccaaa cagagtgtag gatactatgg cgcggaattc cttagggtgg
    4301  ccatacgtgg cgagcgcgcc tacggttact tcgcgcgcgg ggtgagcggg
    4351  ttcgtgaacg gtaactggac ttcgagtgac cccctgtcgt tgactgaggg
    4401  cttatcatca gccattgcct cgtgtcggac cctgatcaac cgatctggcg
    4451  acgcatcact tgcggatctg ctcgggccgg cgatccgcta caggagaggc
    4501  ctcaccacta ggcagaccat tcagctgttg cgcgggacgc tcagtctgga
    4551  gggatcgccc gtcttcaaca cgaattacat tattcggaac ctacgtgttg
    4601  agggcgtaga caaggaaacg gttccgatcg acaaccggtg gaaacggtat
    4651  gcgactaccg actatctcac cgatcaccta tcacccgtag aggtggaagc
    4701  tatacacctg gcgaagaccg accccggtcc cctcatgatt gcctcgggct
    4751  acagaaaagg gctaaatctt gacgacaagg gtactcctag ccaggttagg
    4801  ttccgacctc taccaccccg cctcgcgacg ggcttcgctt ctgcgagcca
    4851  gttgaccgcg cgtcgcgctg agccggggtg cctagcgaaa tatcccgtgt
    4901  tgagcctcat cgcaggacgt ctgaccgacg atgagttgcg tcacctcgtg
    4951  gccatggagg gtggtaacaa tacaacgtca gacatcagga aagaagcctt
    5001  cggtgaatca cccactagca agaacatcat aggctttctt tcctacgccg
    5051  acgccgctgc gctaagtaaa gttactagca gcggtaacat cttcacatcc
    5101  atcagcgtca gagtatagtg ctcggagtgt gaagtaggca gtcgctccgc
    5151  cccttgtggg cgtgattcca ttggccccgt atggggcaaa ctgt