Sequence of DPV Rice yellow mottle virus
Rice yellow mottle virus ORF1 gene for P1 protein, genomic RNA, isolate Ma206
ACC No: HE795650
Dated: 2013-05-22 | Length: 474 | CRC: 1143918343
ID HE795650; SV 1; linear; genomic RNA; STD; VRL; 474 BP. XX AC HE795650; XX DT 22-MAY-2013 (Rel. 116, Created) DT 22-MAY-2013 (Rel. 116, Last updated, Version 1) XX DE Rice yellow mottle virus ORF1 gene for P1 protein, genomic RNA, isolate DE Ma206 XX KW . XX OS Rice yellow mottle virus OC Viruses; ssRNA positive-strand viruses, no DNA stage; Sobemovirus. XX RN [1] RP 1-474 RA Sereme D.; RT ; RL Submitted (22-MAR-2012) to the INSDC. RL INERA, Production Vegetale, BP 476 Ouagadougou 01, 01, BURKINA FASO. XX RN [2] RA Sereme D., Lacombe S., Konate M., Bangratz M., Pinel-Galzi A., Fargette D., RA Traore A.S., Konate G., Brugidou C.; RT "Sites under positive selection in the RNA silencing modulate the RT suppressor activity of Rice yellow mottle virus movement protein P1"; RL Unpublished. XX FH Key Location/Qualifiers FH FT source 1. .474 FT /organism="Rice yellow mottle virus" FT /isolate="Ma206" FT /serotype="Ser-sa" FT /mol_type="genomic RNA" FT /country="Mali" FT /db_xref="taxon:31744" FT CDS 1. .474 FT /transl_table=1 FT /gene="ORF1" FT /product="P1 protein" FT /function="putative movement and gene silencing FT suppression" FT /protein_id="CCG97790.1" FT /translation="MTRLEVLIRPTQQTVAKAITAGYTHALTWVWHSQTWDVDAVNDPV FT LSADFNPEKVGWVSVSFACTQCTAHYYTSEQVKYFINIPPVHYDVVCADCERSVQQDDE FT IDREHDERNAEISACNARALSEGRPASLVYLSRDACDIPEHSGTCRFDKYLNF" XX SQ Sequence 474 BP; 109 A; 124 C; 128 G; 113 T; 0 other; he795650 Length: 474 22-MAY-2013 Type: N Check: 7729 .. 1 atgacacggt tggaagttct tatacgaccg actcagcaga ctgtggcaaa 51 agccatcacc gcgggctata cgcacgcact cacctgggtt tggcattctc 101 agacctggga cgttgacgca gtgaacgatc ctgttctcag cgccgacttc 151 aaccctgaaa aggttggttg ggtgtctgtg tcgtttgcct gtactcagtg 201 tacggctcac tactacacaa gtgagcaggt gaagtatttc atcaatattc 251 cgcctgtcca ctacgacgta gtgtgtgccg attgcgagcg cagtgttcag 301 caggacgacg agatcgaccg cgagcacgac gagcgtaacg cagagatttc 351 cgcctgcaac gctcgagctt tgagcgaggg aagaccagca agtttggttt 401 acctttctcg ggacgcttgt gatatacctg agcactccgg aacgtgccgg 451 tttgacaaat acctcaattt ctga