Sequence of DPV Citrus tristeza virus

Citrus tristeza virus partial CP gene for coat protein, isolate L-Clem1-Mor, clone 3

ACC No: HF947330

Dated: 2013-05-28 | Length: 672 | CRC: 856909577

                
ID   HF947330; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HF947330;
XX
DT   28-MAY-2013 (Rel. 116, Created)
DT   28-MAY-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus partial CP gene for coat protein, isolate
DE   L-Clem1-Mor, clone 3
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Afechtal M.;
RT   ;
RL   Submitted (27-MAR-2013) to the INSDC.
RL   Plant protection, National Institute of Agricultural Research INRA, B.P.
RL   257, 14 rue Abou Temmam, Kenitra, Morocco, 14000, MOROCCO.
XX
RN   [2]
RA   Afechtal M., D'Onghia A.M., Cocuzza G., Djelouah K.;
RT   "Presence of CTV resistance-breaking strain in Morocco: a threat to the
RT   citrus industry in the country";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="L-Clem1-Mor"
FT                   /mol_type="genomic RNA"
FT                   /clone="3"
FT                   /db_xref="taxon:12162"
FT   CDS             <1. .>671
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CCW28902.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSMNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 199 A; 132 C; 166 G; 175 T; 0 other;

hf947330 Length: 672  28-MAY-2013  Type: N  Check: 8963  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgac gttgtcgccg ctgagtcttc tttcggttcc atgaacttac
     101  acatcgatcc aactctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gcatcctaac ttacctgaca aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaaa agttcatcat tacaaagcga tgacgacact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggt aaccgtacca
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgt tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcctg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga