Sequence of DPV Citrus tristeza virus

Citrus tristeza virus partial CP gene for coat protein, isolate L-Val1-Mor, clone 4

ACC No: HF947337

Dated: 2013-05-28 | Length: 672 | CRC: -908691842

                
ID   HF947337; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HF947337;
XX
DT   28-MAY-2013 (Rel. 116, Created)
DT   28-MAY-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus partial CP gene for coat protein, isolate L-Val1-Mor,
DE   clone 4
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Afechtal M.;
RT   ;
RL   Submitted (27-MAR-2013) to the INSDC.
RL   Plant protection, National Institute of Agricultural Research INRA, B.P.
RL   257, 14 rue Abou Temmam, Kenitra, Morocco, 14000, MOROCCO.
XX
RN   [2]
RA   Afechtal M., D'Onghia A.M., Cocuzza G., Djelouah K.;
RT   "Presence of CTV resistance-breaking strain in Morocco: a threat to the
RT   citrus industry in the country";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="L-Val1-Mor"
FT                   /mol_type="genomic RNA"
FT                   /clone="4"
FT                   /db_xref="taxon:12162"
FT   CDS             <1. .>671
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CCW28909.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 196 A; 123 C; 171 G; 182 T; 0 other;

hf947337 Length: 672  28-MAY-2013  Type: N  Check: 3381  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgccg ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgagtact
     151  caacagaatg ctgctttgaa cagggactta tttcttgctc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataagga ctttcacata gctatgatgt
     251  tataccgttt agcggttaag agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc gacatcgtgt ataattctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgctcttta cttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggct gggtatcatt atttgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacagttg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga