Sequence of DPV Citrus tristeza virus

Citrus tristeza virus partial CP gene for coat protein, isolate A5-Bosnia

ACC No: HF947342

Dated: 2013-06-16 | Length: 672 | CRC: -200266219

                
ID   HF947342; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HF947342;
XX
DT   16-JUN-2013 (Rel. 117, Created)
DT   16-JUN-2013 (Rel. 117, Last updated, Version 1)
XX
DE   Citrus tristeza virus partial CP gene for coat protein, isolate A5-Bosnia
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Afechtal M.;
RT   ;
RL   Submitted (15-APR-2013) to the INSDC.
RL   Plant protection, National Institute of Agricultural Research INRA, B.P.
RL   257, 14 rue Abou Temmam, Kenitra, Morocco, 14000, MOROCCO.
XX
RN   [2]
RA   Delic D., Lolic B., Afechtal M., Djelouah K., Karacic A.;
RT   "First report of Citrus tristeza virus in Bosnia and Herzegovina";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="A5-Bosnia"
FT                   /mol_type="genomic RNA"
FT                   /country="Bosnia and Herzegovina"
FT                   /db_xref="taxon:12162"
FT   CDS             <1. .>671
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CCW28894.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSINLHIDSTLIAMNDV
FT                   RQLGTHQNAALNRDLFLTLKGKHPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 200 A; 126 C; 164 G; 182 T; 0 other;

hf947342 Length: 672  16-JUN-2013  Type: N  Check: 3662  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaataagg agacgaaaga
      51  aggcgatgac gttgttgccg ctgagtcttc tttcggttcc ataaacttac
     101  acatcgattc aactctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  catcagaacg ccgctttaaa tagagactta tttcttactt tgaaagggaa
     201  gcatcctaac ttacctgaca aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaaa agttcatcat tacaaagcga tgacgatact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaactt aagttatggc ggacgtccgt tagatgcagg
     501  gattccagcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagttgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga