Sequence of DPV Citrus tristeza virus

Citrus tristeza virus partial CP gene for coat protein, isolate D28-Bosnia

ACC No: HF947348

Dated: 2013-06-16 | Length: 672 | CRC: 1865021082

                
ID   HF947348; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HF947348;
XX
DT   16-JUN-2013 (Rel. 117, Created)
DT   16-JUN-2013 (Rel. 117, Last updated, Version 1)
XX
DE   Citrus tristeza virus partial CP gene for coat protein, isolate D28-Bosnia
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Afechtal M.;
RT   ;
RL   Submitted (15-APR-2013) to the INSDC.
RL   Plant protection, National Institute of Agricultural Research INRA, B.P.
RL   257, 14 rue Abou Temmam, Kenitra, Morocco, 14000, MOROCCO.
XX
RN   [2]
RA   Delic D., Lolic B., Afechtal M., Djelouah K., Karacic A.;
RT   "First report of Citrus tristeza virus in Bosnia and Herzegovina";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="D28-Bosnia"
FT                   /mol_type="genomic RNA"
FT                   /country="Bosnia and Herzegovina"
FT                   /db_xref="taxon:12162"
FT   CDS             <1. .>671
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CCW28900.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSINLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPDLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGVGNRANALRVWGRTNDALYLAFCRQNRSLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 194 A; 129 C; 171 G; 178 T; 0 other;

hf947348 Length: 672  16-JUN-2013  Type: N  Check: 567  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacaac gttgttgccg ctgagtcttc tttcggttcc ataaacttac
     101  acatcgatcc aactttgata gcgatgaatg atgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gcatcctgac ttacctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgacact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgcctgacaa
     351  gctttggact gacgtcgtgt ttaactccaa gggtgttggc aaccgtgcta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgcagacaga atcgcagttt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga