Sequence of DPV Santeuil nodavirus

Santeuil nodavirus isolate JU1264 segment RNA1, complete sequence.

ACC No: HM030972

Dated: 2011-02-06 | Length: 3628 | CRC: -1389328721

                
ID   HM030972; SV 1; linear; genomic RNA; STD; VRL; 3628 BP.
XX
AC   HM030972;
XX
DT   06-FEB-2011 (Rel. 107, Created)
DT   06-FEB-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Santeuil nodavirus isolate JU1264 segment RNA1, complete sequence.
XX
KW   .
XX
OS   Santeuil nodavirus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Nodaviridae;
OC   unclassified Nodaviridae.
XX
RN   [1]
RP   1-3628
RA   Felix M.-A., Ashe A., Piffaretti J., Wu G., Nuez I., Belicard T., Jiang Y.,
RA   Zhao G., Franz C.J., Goldstein L.D., Sanroman M., Miska E.A., Wang D.;
RT   "Natural and Experimental Infection of Caenorhabditis Nematodes by Novel
RT   Viruses Related to Nodaviruses";
RL   PLoS Biol. 9(1):e1000586-e1000586(2011).
XX
RN   [2]
RP   1-3628
RA   Wang D.;
RT   ;
RL   Submitted (23-MAR-2010) to the EMBL/GenBank/DDBJ databases.
RL   Molecular Microbiology, Washington University in St. Louis, 4940 Parkview
RL   Place, St. Louis, MO 63110, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3628
FT                   /organism="Santeuil nodavirus"
FT                   /segment="RNA1"
FT                   /host="Caenorhabditis briggsae"
FT                   /isolate="JU1264"
FT                   /mol_type="genomic RNA"
FT                   /country="France"
FT                   /collection_date="2007"
FT                   /db_xref="taxon:977913"
FT   CDS             609. .3557
FT                   /codon_start=1
FT                   /product="RNA dependent RNA polymerase"
FT                   /note="protein A"
FT                   /protein_id="ADW54431.1"
FT                   /translation="MESSPITPSRKGFLAKTQDAATTFIRHSVPIPVLGMIRALEVLTG
FT                   SKVAAVLLTPTSLIAAVNQLYRWIAYLAAKRTGVKIPKVFSFGIHAFSLYLVYKFARIV
FT                   YHWVFNKDLAENAIRQRDNWTAISLWAGVQIHGEVKARMFRPLLPANHTTHRSWTTVED
FT                   TIVLTTNDQTTHHPNLIAWNGEIVLTQDICFPLHVSCSRRPGDTLFIDYVFKRSSNIAP
FT                   HSITGTLFSTDLMSNNQYSCRSEWHGGALNVYLAPARSYTTFSTTRKNWETIMHQFTVN
FT                   GAKAQNYTVMNLLQTLIPTSQQADRLFAGGLIASYWNRCADMDVIEERVRHRGEIQFVN
FT                   DVRDDKFAPWKLTGRTVGPHFVTTPNTMPYKGHQNDLSAIEFRLDAKRNPHETLSQNVH
FT                   AKMDEFVKLLNPQKIHRWTHRQVIENQTKPMQIRRNEEAAKVIGWLHALKCKVKAMLKV
FT                   EAINQSGATRNISTVGAEFNLEYGSFMLPAAEWLKQNTKWYTAGKPPKEIAIRVRELAT
FT                   QARTRNAEPYLCCADVSKMDAGKHVEITAYLLSVIYFSMFPDDIDTLANLRTTEATAEA
FT                   HTNTGMKYKIGGSQLSGSASTTIDNTVTNAFISYYAHRVEGRCPTEAYAALGIYVGDDS
FT                   VSHNTTESIEQAGRDLGYTLTSEIIKEGEPVPFLSRYFYQPWEQGLSSFQDPMRLLSKL
FT                   HLSIAPMYIPDATAFLNKMRGLTELDPAIFLYKALYDKMQDLVGIVGTSNSDDTPWYTR
FT                   TFGAGESWPTDHEAQIRWEAIVGIAPNTYATWLLKIHTYEQLMTIAPPKADNTAKPKLQ
FT                   HSLDPTVPGVEAPPSTDPAPDHATIGVSQSSAIDLMNAIEDKVEFAIANVASRMSRGLP
FT                   PAPRSLLAPQTDRQPGENQDCLFGPNEKKKKKKSGPPTAKHRAAPAVTPTAPPAEEEPT
FT                   TAPSAPAPAPIPIEDLMAMADAGNLRRPRRSTVPNPNASHPRGRPPPPSGVT"
XX
SQ   Sequence 3628 BP; 1011 A; 1128 C; 826 G; 663 T; 0 other;

hm030972 Length: 3628  06-FEB-2011  Type: N  Check: 7125  ..

       1  tattatcata ctgacaatgg taatatgcga gagcgatagc aagcactaga
      51  aacgagttac gcaaccacag acagcaagcc cggaaggcgc gcagagactg
     101  aacacctctg tgtggctgaa ggctccccac taaccctgga gagaagtggc
     151  agaaccacag cctagtacta gccgcaaggc ttaagaaact aggtgtagct
     201  gagtcctttc ccttaaacaa ggattggacc acttgtagga tccgtgtatt
     251  caaacgatct ggcagcacta tggctcggac aggtacaacc aataaacaca
     301  agcgttttga gaaaccggcg tgattgtacc gcagttttaa aggagcttca
     351  aaccctccca gccgaaagat caaacgaagt cgtagttgaa ctaacgtagt
     401  aggggagcgg cgtttgagga tgttcacggg tcagtaacgt gaatagcttc
     451  attcgtgacg tgctcaaacc accgtatagg ttcgccttag tcattagcag
     501  ggatggctag gttcagctgc gcatgcacaa accacaacaa taaactaaac
     551  tttattcgcg tatttgtgca ttcccgttgc ccacccacac tcctaacaaa
     601  tttcaagtat ggagtcgtca ccaatcaccc cctctcgaaa aggcttccta
     651  gctaaaacgc aggacgccgc cacaaccttc atccgccact cagtcccaat
     701  ccccgtactc ggtatgattc gggcccttga agtgcttact ggaagcaaag
     751  tagccgcagt gctcttgacc cccacttctc taatcgcagc cgtcaaccag
     801  ctttaccgtt ggattgctta tttggccgct aagaggacag gagtcaagat
     851  cccaaaagtg ttttcgttcg gaatccacgc attctcgttg tatctggtct
     901  acaagttcgc gagaatcgtg taccattggg tcttcaataa ggacctcgcc
     951  gaaaacgcca tccgtcaacg tgacaactgg acagccatct ccttgtgggc
    1001  tggagtccag atccacggag aagtgaaagc tcggatgttt agaccactgc
    1051  tacccgccaa ccacacaacg caccgctcat ggaccacagt agaagacaca
    1101  atcgtactca cgaccaacga ccagaccaca caccacccca acttgatcgc
    1151  ctggaacgga gagatcgtcc tcactcagga catctgcttc ccgctccatg
    1201  taagttgttc cagaaggcca ggagacacgt tattcatcga ttacgtgttc
    1251  aaacgaagtt ccaacatcgc cccacactcg atcaccggta ccctcttctc
    1301  caccgatctg atgtccaaca accagtactc ttgccgtagt gaatggcacg
    1351  gaggcgctct aaacgtatac ctcgcccccg ccagatccta caccaccttc
    1401  tccacgacaa ggaagaactg ggagaccatc atgcaccaat tcaccgttaa
    1451  cggcgcgaaa gcccagaact acacggtgat gaatctgctc cagacgctaa
    1501  tccccacctc acagcaggcc gaccgcctgt tcgccggagg gttgatcgca
    1551  tcctactgga acagatgtgc cgacatggac gtcatcgagg agagagtccg
    1601  ccaccgcggt gagatccaat tcgtgaacga tgtcagagat gacaagttcg
    1651  ccccatggaa actcaccggc agaaccgtcg gaccacactt cgtcaccacc
    1701  cctaacacca tgccatacaa aggacaccag aatgacttat cggccatcga
    1751  gtttagactc gacgccaaac ggaaccccca tgagactctc agccaaaacg
    1801  tccacgccaa gatggatgag ttcgtaaaac tactcaatcc acagaagatc
    1851  cacagatgga cacacagaca ggtcattgag aaccagacga aaccaatgca
    1901  aatccgcaga aatgaggagg ctgcaaaggt catcggttgg ctccatgccc
    1951  tgaagtgcaa agtcaaggct atgctgaaag ttgaagccat caaccaatcc
    2001  ggagccacca gaaacatcag cacagtcggg gccgaattca accttgaata
    2051  cggttccttc atgcttcccg ctgctgaatg gctcaagcag aacacgaaat
    2101  ggtacacagc tggtaaaccc ccaaaggaga tagccatccg agtaagggaa
    2151  ctagccaccc aggcaagaac ccgaaacgct gaaccatatc tgtgctgcgc
    2201  ggatgtctcc aagatggatg ccggaaaaca cgtcgagata actgcctacc
    2251  tactctcagt catatacttc tccatgttcc cagatgatat cgacaccctc
    2301  gccaacctca ggacaaccga ggccacagcc gaggcacaca cgaacactgg
    2351  aatgaagtac aaaatcggag gcagtcaact gtctggaagc gccagcacca
    2401  ccatcgacaa cacagtcacc aacgctttca tctcctacta cgctcaccgc
    2451  gtcgaaggaa gatgtccgac agaggcttat gccgctctcg gaatctacgt
    2501  tggtgatgac tcggtcagcc acaacaccac ggaatccatc gaacaagccg
    2551  ggcgtgacct cggttacacc ctcacctccg agatcatcaa ggaaggcgag
    2601  ccagttccgt tcctgtcccg gtacttctac caaccatggg aacagggact
    2651  cagctcattc caagacccga tgcgactcct atccaaactc cacctctcca
    2701  tagcaccaat gtacatcccg gacgccaccg cattcctcaa caagatgcga
    2751  ggactcaccg agttggaccc cgccatcttc ctctacaagg ctctgtatga
    2801  taaaatgcag gaccttgttg ggattgtcgg gacctccaac tcagacgaca
    2851  caccgtggta caccaggacg tttggagctg gagagagttg gccgaccgac
    2901  cacgaggcac aaattcgatg ggaagccatc gttggcatcg cccccaacac
    2951  ctatgcaacc tggctactaa agatccacac gtacgaacag ctcatgacta
    3001  tcgccccgcc caaagccgac aacactgcta agccgaagct ccaacactcc
    3051  ctcgacccaa cagtcccggg agtggaagcc cctcctagca ccgatccggc
    3101  cccagatcac gctacgatag gagtgagcca gtcgtcggcc atcgacctca
    3151  tgaacgccat cgaggacaag gtcgagttcg ccatcgccaa cgttgcatcc
    3201  cgcatgagtc gcggactgcc accagcaccc cgttcgctgc tggctcctca
    3251  gacggaccgt caacctggag aaaaccagga ttgcttattt ggccccaatg
    3301  agaagaagaa gaagaagaag agcggacccc ccacagcaaa acatcgggca
    3351  gccccggcgg tgacaccaac agcaccaccc gccgaagagg aaccaacaac
    3401  agcaccatcc gccccagcac cggcaccaat ccccatcgaa gatctgatgg
    3451  ccatggctga cgccggcaac ctacgaagac ctaggcggtc cacggttcct
    3501  aaccctaatg cctctcaccc gagaggaagg ccaccaccac ccagtggagt
    3551  cacctaacgg tgactaggcc gaaacgtgtg tcagagcgcg aacactccaa
    3601  cctactctga cgtcccttaa ggactggt