Sequence of DPV Santeuil nodavirus

Santeuil nodavirus isolate JU1264 segment RNA2, complete sequence.

ACC No: HM030973

Dated: 2011-02-06 | Length: 2653 | CRC: 1704670837

                
ID   HM030973; SV 1; linear; genomic RNA; STD; VRL; 2653 BP.
XX
AC   HM030973;
XX
DT   06-FEB-2011 (Rel. 107, Created)
DT   06-FEB-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Santeuil nodavirus isolate JU1264 segment RNA2, complete sequence.
XX
KW   .
XX
OS   Santeuil nodavirus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Nodaviridae;
OC   unclassified Nodaviridae.
XX
RN   [1]
RP   1-2653
RA   Felix M.-A., Ashe A., Piffaretti J., Wu G., Nuez I., Belicard T., Jiang Y.,
RA   Zhao G., Franz C.J., Goldstein L.D., Sanroman M., Miska E.A., Wang D.;
RT   "Natural and Experimental Infection of Caenorhabditis Nematodes by Novel
RT   Viruses Related to Nodaviruses";
RL   PLoS Biol. 9(1):e1000586-e1000586(2011).
XX
RN   [2]
RP   1-2653
RA   Wang D.;
RT   ;
RL   Submitted (23-MAR-2010) to the EMBL/GenBank/DDBJ databases.
RL   Molecular Microbiology, Washington University in St. Louis, 4940 Parkview
RL   Place, St. Louis, MO 63110, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2653
FT                   /organism="Santeuil nodavirus"
FT                   /segment="RNA2"
FT                   /host="Caenorhabditis briggsae"
FT                   /isolate="JU1264"
FT                   /mol_type="genomic RNA"
FT                   /country="France"
FT                   /collection_date="2007"
FT                   /db_xref="taxon:977913"
FT   CDS             230. .1255
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /note="protein A"
FT                   /protein_id="ADW54432.1"
FT                   /translation="MLKGVDRIVTVKDATTLTPGKSVVSLLITPLIADRLRAASQMFQK
FT                   IKYHKLVFRVNSQCSTMTAGGYVAGFVKDPADEIPSESVAVQYLMSNAGSYTQPWWRST
FT                   VHNIRASQRMFFTDKPALGADAIREYSPGRFYVIVDSTPSQTCPVTVDLEWTVELREAT
FT                   FKLPDTTTVISSIRPELSLSTYGMPNTSPMAGHVVVKPSGETPRWLTPARFQTMFGFAP
FT                   DEDMCATIPTPVQCVLTGENAYQTVTATHFSAVLTDSAVQSFMLSAFNDVTQDIQPINH
FT                   TWQIMDALGQIVTPFIAVIYDSAIWSATDSYTITTRTGKPVPLDVFRFLHPNATVLPPE
FT                   N"
FT   CDS             1384. .2382
FT                   /codon_start=1
FT                   /product="protein delta"
FT                   /protein_id="ADW54433.1"
FT                   /translation="MAALQASVLTQGRPSDDYTAWFNETVGPKFDELITQIKIIADCVS
FT                   DNQIRAKLDQVVKVEVENEVPVRVEHEVKVHVENEYLPVRNRYIHLEEVEFPEPLFVLA
FT                   AEKDVSGHSKKFECEITNEPKVHIEGQPLQVDIANQPIRVTGDEPGSNHVIIDNFPEVQ
FT                   HVILDNHVVIGNPDPITVTIDPESTVNVVGYVDANIINSVVLPVDVVKPISVDNFPTTV
FT                   TVDNGFSDPIPICQLIRTLEATDMPANNVGGTGVFRELSTQHPLPSYQVGPDNGEHHLM
FT                   APQGAVFPRAVTTDGYVWADSQYARLPDVYLHEVIGGGHRTVISVKDQPHE"
XX
SQ   Sequence 2653 BP; 737 A; 766 C; 612 G; 538 T; 0 other;

hm030973 Length: 2653  06-FEB-2011  Type: N  Check: 1141  ..

       1  taatgacgca agtcactact tgggcctcac aaccccgtga aaacgacgat
      51  ggattggtac tccattgtaa tagtgctgtc aaaccaacaa gaacaacaag
     101  aagaacataa gccggaagct gaaaccggcg aaacaacagc cacctcgtaa
     151  aagaaatact caacgaagaa gtgctctcgc accgatcgct cgttccaacc
     201  aacttcgaca gaccaacgga aattctatca tgctcaaggg tgtggacagg
     251  attgttacgg ttaaagacgc aacaaccctg actcccggaa aatccgttgt
     301  ttcactcctc ataaccccgc tcattgccga tcgtttgcgc gcagcatcac
     351  agatgttcca gaagatcaag taccacaagc ttgtctttcg tgtgaacagt
     401  cagtgttcga caatgactgc cggtggatac gtcgcaggct tcgtaaaaga
     451  cccagccgac gaaatcccga gtgagtccgt tgcagttcaa tatctcatgt
     501  ccaatgcagg atcatacacc caaccatggt ggcgatccac tgtccacaac
     551  atcagagcgt cccagcggat gttcttcacg gacaaaccag cactgggcgc
     601  cgacgcgatc cgagagtact ctccaggcag attctatgtc atcgtcgatt
     651  ccactccaag tcaaacatgt ccagtcaccg tcgacctgga atggacagtg
     701  gaattgagag aagctacctt caaattgccg gacactacca ccgtcatctc
     751  cagcatccgc ccagagctct ctcttagtac atatggaatg ccaaacacat
     801  caccaatggc tggacatgtg gttgtcaaac ccagcggaga aacaccccgc
     851  tggctcacac ccgccaggtt ccaaactatg tttggttttg cgcctgatga
     901  agacatgtgt gccaccattc caaccccagt ccagtgtgta ttgaccggag
     951  aaaatgccta ccaaacagtc accgcaacgc atttctccgc tgtgcttacc
    1001  gacagcgcag tccaatcgtt catgctatcc gctttcaatg atgtcaccca
    1051  agacattcag ccgatcaacc acacgtggca gatcatggat gcactcgggc
    1101  aaatcgtcac acccttcatc gccgtcatct atgactccgc catctggtcc
    1151  gctactgaca gctacaccat caccaccaga accggaaaac cagtaccgct
    1201  ggatgtattc cggttcctac accccaatgc caccgttctc ccaccggaaa
    1251  actagcttgg ggtaatgtcg tgcagcagac aggacccaac gaactctaca
    1301  tccaatggat ctcccatcag gtgtttcagt cgcaactaac tcggccgagc
    1351  aacgactatg acgcatggta cataagggca accatggcag cattgcaagc
    1401  atctgtccta acacaaggca gaccatcaga cgactacaca gcgtggttca
    1451  atgagaccgt cggacccaaa ttcgacgagc tcatcacgca gattaagatc
    1501  atcgccgatt gcgtctctga caaccaaatc agggccaaac tggaccaagt
    1551  agtcaaagtc gaagtggaga atgaagtacc agttagagtt gaacatgagg
    1601  tcaaggtgca tgttgagaac gagtatttgc cagtcaggaa caggtatatc
    1651  catcttgagg aagtcgaatt ccccgagccc ctgttcgtgt tagcggccga
    1701  gaaggacgtc tcgggtcact caaagaaatt cgagtgcgag ataacgaatg
    1751  aacctaaggt ccacatagaa ggtcagcctt tgcaagtaga tatcgccaat
    1801  caaccgatcc gggtcaccgg agacgaacct ggttccaatc acgtcatcat
    1851  cgacaacttc ccagaagtac aacacgtgat tttggataac cacgtcgtca
    1901  tcggcaaccc tgaccccatc acggttacta tcgatccaga atcgacggtc
    1951  aacgtggtgg gttacgtaga tgctaacata atcaactcag ttgtactacc
    2001  agttgatgtc gtgaagccta tatcagtcga taacttccca acaacggtca
    2051  cggtggacaa cggattcagt gacccgatac ccatctgcca gctcatccgc
    2101  actctcgaag ccacggacat gccagccaac aacgtcggag ggaccggagt
    2151  attccgggaa ctttcaactc agcacccact gccgagttac caggttggac
    2201  ccgataacgg cgaacatcac ctcatggcac cgcaaggagc agtcttccca
    2251  cgagcagtca ctactgacgg ctatgtttgg gccgactcgc agtacgccag
    2301  actacctgac gtctatctac atgaagtgat cggaggaggc caccgcacag
    2351  tgatctccgt caaagaccag ccgcacgagt gacgtggttt acgttcaacg
    2401  agagtcgatg gccagcgttg gagggcatca aacgtcgttt gacaggtacc
    2451  agcgactaga tccggtgtag cccgctgcta caacacacac tgacatgtgt
    2501  gcaaccgctc accccgccac gggggtgcac cctaacaggg atgaaaagta
    2551  cgtggccgct acccacaagc gttaaatggc ggagtgtcag ctccgcaaga
    2601  ccgtgggaat ccacatactt ccgcaaggtt gatgtggatt ttaaaaaggt
    2651  cgt