Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Montpelier-H18 coat protein gene, complete cds.

ACC No: HM160508

Dated: 2012-05-28 | Length: 672 | CRC: -265351442

                
ID   HM160508; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HM160508;
XX
DT   28-MAY-2012 (Rel. 112, Created)
DT   28-MAY-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate Montpelier-H18 coat protein gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Fisher L.C., Tennant P.F., McLaughlin W.A.;
RT   "Molecular characterization of the coat protein gene of some biological
RT   Jamaican Citrus tristeza virus isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Fisher L.C., Tennant P.F., McLaughlin W.A.;
RT   ;
RL   Submitted (28-APR-2010) to the INSDC.
RL   Life Sciences, University of the West Indies, Mona Campus, 2 St. John's
RL   Close, Kingston 7 0, Jamaica
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sp."
FT                   /strain="severe"
FT                   /isolate="Montpelier-H18"
FT                   /mol_type="genomic RNA"
FT                   /country="Jamaica"
FT                   /collection_date="Mar-2007"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AEG77341.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGSRANALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 188 A; 122 C; 179 G; 183 T; 0 other;

hm160508 Length: 672  28-MAY-2012  Type: N  Check: 5335  ..

       1  atggacgacg agacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacaat gttgttgcag cggagtcttc cttcggttct gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ccgctttgaa cagagatttg tttcttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacact
     301  acgggtataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt agccgtgcta
     401  acgcccttcg agtctggggt aggactaacg atgcccttta tttagccttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcggg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagagtgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga