Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Montpelier-J35 coat protein gene, complete cds.

ACC No: HM160510

Dated: 2012-05-28 | Length: 672 | CRC: 942780814

                
ID   HM160510; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HM160510;
XX
DT   28-MAY-2012 (Rel. 112, Created)
DT   28-MAY-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate Montpelier-J35 coat protein gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Fisher L.C., Tennant P.F., McLaughlin W.A.;
RT   "Molecular characterization of the coat protein gene of some biological
RT   Jamaican Citrus tristeza virus isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Fisher L.C., Tennant P.F., McLaughlin W.A.;
RT   ;
RL   Submitted (28-APR-2010) to the INSDC.
RL   Life Sciences, University of the West Indies, Mona Campus, 2 St. John's
RL   Close, Kingston 7 0, Jamaica
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sp."
FT                   /strain="severe"
FT                   /isolate="Montpelier-J35"
FT                   /mol_type="genomic RNA"
FT                   /country="Jamaica"
FT                   /collection_date="Mar-2007"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AEG77343.1"
FT                   /translation="MDDETKKLKNKNKEAKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLGTQQNAALNGDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVDLSDKLWTDVVFNSEGTGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 193 A; 124 C; 173 G; 182 T; 0 other;

hm160510 Length: 672  28-MAY-2012  Type: N  Check: 1862  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aagcgaaaga
      51  aggcgacgat gttgtagctg ccgagtcttc ttttggttcc gtaaacttac
     101  acatcgatcc gactttgata acgatgaacg atgtgcgtca gttgggcacc
     151  caacagaacg ctgctttgaa cggagactta ttccttactt tgaaagggaa
     201  gtatcctaac ttacctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgacgcc
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgtctgataa
     351  actttggact gacgtcgtgt ttaactctga gggtactggt aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgcagacaga atcgcaattt gagttatggc ggacgtccgc tagacgcagg
     501  gattccggcc gggtatcatt acttgtgtgc ggatttcttg actggagctg
     551  gtttgactga cttagaatgt gctgtgtaca tacaagctaa agaacaatta
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga