Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Arscott28 coat protein gene, complete cds.

ACC No: HM160513

Dated: 2012-05-28 | Length: 672 | CRC: -1973744190

                
ID   HM160513; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HM160513;
XX
DT   28-MAY-2012 (Rel. 112, Created)
DT   28-MAY-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate Arscott28 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Fisher L.C., Tennant P.F., McLaughlin W.A.;
RT   "Molecular characterization of the coat protein gene of some biological
RT   Jamaican Citrus tristeza virus isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Fisher L.C., Tennant P.F., McLaughlin W.A.;
RT   ;
RL   Submitted (28-APR-2010) to the INSDC.
RL   Life Sciences, University of the West Indies, Mona Campus, 2 St. John's
RL   Close, Kingston 7 0, Jamaica
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sp."
FT                   /strain="severe"
FT                   /isolate="Arscott28"
FT                   /mol_type="genomic RNA"
FT                   /country="Jamaica"
FT                   /collection_date="Mar-2007"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AEG77346.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSMNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWNDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFST
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 127 C; 168 G; 179 T; 0 other;

hm160513 Length: 672  28-MAY-2012  Type: N  Check: 1445  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgac gttgttgccg ctgagtcttc tttcggttcc atgaacttac
     101  acatcgatcc aactctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gcatcctaac ttacctgaca aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt ggcagttaaa agttcatcat tacaaagcga tgacgacact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgcctgacaa
     351  actttggaat gacgtcgtgt ttaactccaa gggtattggt aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgt tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattt agcacacgtt ga