Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate MileGully9 coat protein gene, complete cds.

ACC No: HM160516

Dated: 2012-05-28 | Length: 672 | CRC: -838455009

                
ID   HM160516; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HM160516;
XX
DT   28-MAY-2012 (Rel. 112, Created)
DT   28-MAY-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate MileGully9 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Fisher L.C., Tennant P.F., McLaughlin W.A.;
RT   "Molecular characterization of the coat protein gene of some biological
RT   Jamaican Citrus tristeza virus isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Fisher L.C., Tennant P.F., McLaughlin W.A.;
RT   ;
RL   Submitted (28-APR-2010) to the INSDC.
RL   Life Sciences, University of the West Indies, Mona Campus, 2 St. John's
RL   Close, Kingston 7 0, Jamaica
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sp."
FT                   /strain="severe"
FT                   /isolate="MileGully9"
FT                   /mol_type="genomic RNA"
FT                   /country="Jamaica"
FT                   /collection_date="Mar-2007"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AEG77349.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGMT
FT                   YTRDGVEVELSEKLWTDVVFTLRVLVIVLTPFESGVELTMPFIWLFVYLTATLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 196 A; 118 C; 167 G; 191 T; 0 other;

hm160516 Length: 672  28-MAY-2012  Type: N  Check: 7131  ..

       1  atggacgacg aaactaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcgg ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactttgata gcgatgaacg atgtacgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ttttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtatga cgtacactcg ggatggtgtt gaagtggaat tgtctgagaa
     351  actttggaca gacgtcgtgt ttactctaag ggtattggta atcgtactaa
     401  cgcccttcga gtctggggta gaactaacga tgccctttat ttggcttttt
     451  gtatatttaa ccgcaacttt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagccg
     551  gcttgactga tttagaatgt gcagtgtaca tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tggcaaattt aacacacgtt ga