Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Knockalva11 coat protein gene, complete cds.

ACC No: HM160518

Dated: 2012-05-28 | Length: 672 | CRC: 230158048

                
ID   HM160518; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HM160518;
XX
DT   28-MAY-2012 (Rel. 112, Created)
DT   28-MAY-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate Knockalva11 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Fisher L.C., Tennant P.F., McLaughlin W.A.;
RT   "Molecular characterization of the coat protein gene of some biological
RT   Jamaican Citrus tristeza virus isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Fisher L.C., Tennant P.F., McLaughlin W.A.;
RT   ;
RL   Submitted (28-APR-2010) to the INSDC.
RL   Life Sciences, University of the West Indies, Mona Campus, 2 St. John's
RL   Close, Kingston 7 0, Jamaica
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sp."
FT                   /strain="severe"
FT                   /isolate="Knockalva11"
FT                   /mol_type="genomic RNA"
FT                   /country="Jamaica"
FT                   /collection_date="Mar-2007"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AEG77351.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCQTESQFELWRTS
FT                   ARRRIPVGNRHHVCGFLDWSWFDDLECAVYIQAKEQLLKKRGADEVVVPILRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 195 A; 128 C; 169 G; 180 T; 0 other;

hm160518 Length: 672  28-MAY-2012  Type: N  Check: 2666  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgtagctg ccgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactttgata acgatgaacg atgtgcgtca gttgggcacc
     151  caacagaacg ctgctttgaa cagagactta ttccttactt tgaaagggaa
     201  gtatcctaac ttacctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgacgcc
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgtctgataa
     351  actttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgccagacag aatcgcaatt tgagttatgg cggacgtccg ctagacgcag
     501  gattccggtc gggaatcgtc accacgtgtg cggatttctt gactggagct
     551  ggtttgacga tttagaatgt gctgtgtaca tacaagctaa agaacaatta
     601  ttgaagaagc gaggggctga tgaagtcgta gttcctattc tcaggcagct
     651  tgggaaattt aacacacgtt ga