Sequence of DPV Pelargonium leaf curl virus

Pelargonium leaf curl virus coat protein gene, complete cds.

ACC No: HM461992

Dated: 2010-12-01 | Length: 1221 | CRC: 1971212964

                
ID   HM461992; SV 1; linear; genomic RNA; STD; VRL; 1221 BP.
XX
AC   HM461992;
XX
DT   01-DEC-2010 (Rel. 107, Created)
DT   01-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Pelargonium leaf curl virus coat protein gene, complete cds.
XX
KW   .
XX
OS   Pelargonium leaf curl virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1221
RA   Safari M., Koohi Habibi M., Mosahebi G.H., Dizaji A.;
RT   "Characterization of an Iranian isolate of Pelargonium leaf curl virus
RT   infecting pelargoniums";
RL   Unpublished.
XX
RN   [2]
RP   1-1221
RA   Safari M., Koohi Habibi M., Mosahebi G.H., Dizaji A.;
RT   ;
RL   Submitted (07-JUN-2010) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, University of Tehran, Faculty of Agricultural Science and
RL   Engineering, Karaj, Tehran 31587-11167, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1221
FT                   /organism="Pelargonium leaf curl virus"
FT                   /host="Pelargonium"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran"
FT                   /collection_date="Mar-2008"
FT                   /db_xref="taxon:35280"
FT   CDS             38. .1207
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADR01740.1"
FT                   /translation="MAMVRRNNNTSIIPVTGMQLATIVGTAVAGAVGNVVKNNGGAIAR
FT                   TAVGFGKQVVKRFRKKKGGGNQQMIQHVGGTGGAIMAPVAVTRQLMGSKPKFTGRMSGS
FT                   VTVTHREYLTQVNNTTAFAVNGGIVDNLLQLNPLNGTLFAWLPAIASNFDQYTFNNVVL
FT                   HYVPLCATTEVGRVAMYFDKDSEDVEPADRVELANYGVLKETAPWAEATLNIPCDRVKR
FT                   YCDDSATVDHKLIDLGQLGIATYGGSGTNAIGDVFISYSVTLYYPQPTNSLLSTRRLDL
FT                   TGASLNGNGPGYTIVSRTPTVISMTFRSTGTFVLTGAYRCLTASTLGLTGNVNVNSITV
FT                   LDTLGLATSFIINCTVSSLPSVVSFTSTGITSATINCVRATRANVVTLA"
XX
SQ   Sequence 1221 BP; 328 A; 270 C; 302 G; 321 T; 0 other;

hm461992 Length: 1221  01-DEC-2010  Type: N  Check: 2437  ..

       1  cgcgtacctt gaccagaata cacaactaga gaagataatg gcaatggtac
      51  gtagaaataa caacacatca attataccag ttactggcat gcagttggca
     101  actattgttg gcactgcggt agctggtgct gttgggaatg tcgtgaagaa
     151  caatggtggg gcaatagcaa gaacagccgt tggttttggg aagcaagtag
     201  taaaaagatt tagaaagaag aaaggaggag gaaatcagca gatgatacaa
     251  catgtaggtg gtacaggtgg ggccattatg gccccggtgg cagtgactag
     301  acaactcatg ggaagtaagc ctaaattcac aggtagaatg tctggatctg
     351  tcacagtaac ccaccgtgag tacctaactc aggtcaataa caccactgcg
     401  tttgcggtaa atggggggat tgtcgacaat ttgttacagc tcaacccgtt
     451  gaatgggaca ctgttcgcat ggttaccggc tatagcctct aacttcgacc
     501  agtacacatt caacaatgtt gtgctacatt atgtgcccct gtgtgccacc
     551  actgaggtgg gacgtgtggc aatgtacttt gataaggact cggaggatgt
     601  tgaacctgct gatagagttg agttggctaa ttacggagtg ctcaaagaga
     651  cagccccctg ggctgaagct accctgaata tcccttgtga tcgggttaag
     701  agatactgtg atgacagtgc tactgtagat cataaactta tcgacttggg
     751  acagctgggc atagctacat atggtggctc cgggactaac gctattggag
     801  atgtcttcat ttcctatagt gtcacgttat attaccctca acctacgaac
     851  tctctcctta gtactaggcg ccttgatctc acgggtgctt ccctcaatgg
     901  taacggacct ggatacacta ttgtgtcccg aacacccact gttatcagta
     951  tgaccttcag gtctactggc acgtttgtct taaccggggc gtatcggtgc
    1001  ttgactgcat ctactctcgg gcttactggc aacgtgaatg tgaacagcat
    1051  tacggtattg gacacacttg gactagcaac tagtttcatt atcaattgca
    1101  cagtgtcctc attaccgtct gttgtcagct tcacatctac cggcatcacc
    1151  tctgccacca taaactgtgt tagagctact agagcaaatg ttgttacact
    1201  agcataatct tctctagagg g