Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMC2 coat protein gene, complete cds.

ACC No: HQ012375

Dated: 2011-01-16 | Length: 672 | CRC: 1024139025

                
ID   HQ012375; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012375;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMC2 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus x paradisi x Citrus trifoliata"
FT                   /isolate="AMC2"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Cameron Highland"
FT                   /collection_date="Mar-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15566.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSLNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFSRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADDVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 193 A; 127 C; 174 G; 178 T; 0 other;

hq012375 Length: 672  16-JAN-2011  Type: N  Check: 1780  ..

       1  atggacgacg aaacaaagaa attgaagaac aagaacaagg aaacgaaaga
      51  aggcgacaat gttgtcgcag cggagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgagtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  agtagacaga atcgcaattt gagttatggc ggacgtccgc tagacgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgatgtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga