Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMC13 coat protein gene, complete cds.

ACC No: HQ012378

Dated: 2011-01-16 | Length: 672 | CRC: 2097579604

                
ID   HQ012378; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012378;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMC13 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata"
FT                   /isolate="AMC13"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Cameron Highland"
FT                   /collection_date="Mar-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15569.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKEQLLKKRGADEVVVTNVRQLGKFTP
FT                   R"
XX
SQ   Sequence 672 BP; 195 A; 124 C; 167 G; 186 T; 0 other;

hq012378 Length: 672  16-JAN-2011  Type: N  Check: 5479  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcc ttaaatttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa cagagatttg tttcttactt tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataaaga ctttcactta gccatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tacaaagcga cgatgacact
     301  acgggtataa cgtacactcg ggagggtgtt gaagttgatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaactctaa aggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaaa accgcaattt gagttatggt ggacgtccgt tagatgcggg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttaacaga tttagaatgt gcagtgtact tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattc acaccccgtt ga