Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMJ1 coat protein gene, complete cds.

ACC No: HQ012383

Dated: 2011-01-16 | Length: 672 | CRC: -534939385

                
ID   HQ012383; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012383;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMJ1 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="x Citrofortunella microcarpa"
FT                   /isolate="AMJ1"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Jengka"
FT                   /collection_date="Feb-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15574.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGKRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 127 C; 169 G; 178 T; 0 other;

hq012383 Length: 672  16-JAN-2011  Type: N  Check: 1185  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaacg ccgctttgaa cagagatttg tttctcactt tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataaaga ctttcacata gccatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagtga cgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  actttggacc gacgtcgtgt ttaactctaa gggtattggt aaacgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaaa accgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  aattccggcc ggatatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agagcaattg
     601  ttgaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga