Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMJ12 coat protein gene, complete cds.

ACC No: HQ012384

Dated: 2011-01-16 | Length: 672 | CRC: -1922315815

                
ID   HQ012384; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012384;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMJ12 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="x Citrofortunella microcarpa"
FT                   /isolate="AMJ12"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Jengka"
FT                   /collection_date="Feb-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15575.1"
FT                   /translation="MDDETKKLKNKNKEAKEGDDVVAAESSFSSVDLHIDPTLIAMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDGTGIT
FT                   YTREGVEVDLSDKLWTDVVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYQYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFTP
FT                   R"
XX
SQ   Sequence 672 BP; 193 A; 125 C; 176 G; 178 T; 0 other;

hq012384 Length: 672  16-JAN-2011  Type: N  Check: 1210  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aagcgaaaga
      51  aggcgacgat gttgttgcgg ctgagtcttc tttcagttcc gtagacttac
     101  acatcgatcc gactctgata gcgatgaatg atgtgcgtca gttaagcact
     151  caacagaatg ctgctttgaa cagggactta tttcttactt tgaaagggaa
     201  gtatcctaac ttaccagaca aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagcga tgacgacggt
     301  acgggcataa cttacactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ataactctaa gggtattggt aaccggacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta cttagccttt
     451  tgtagacaga atcgcaattt gagttacggc ggacgtccgt tagacgcggg
     501  gattccggcc gggtatcaat atctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaggtcgta gttactaatg tcagacagct
     651  tgggaaattc acaccacgtt ga