Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMK19 coat protein gene, complete cds.

ACC No: HQ012390

Dated: 2011-01-16 | Length: 672 | CRC: -1335604156

                
ID   HQ012390; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012390;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMK19 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia"
FT                   /isolate="AMK19"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Keluang"
FT                   /collection_date="Jan-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15578.1"
FT                   /translation="MGGATKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLRAQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFTP
FT                   R"
XX
SQ   Sequence 672 BP; 190 A; 126 C; 178 G; 178 T; 0 other;

hq012390 Length: 672  16-JAN-2011  Type: N  Check: 1877  ..

       1  atgggagggg caacaaagaa actgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc attcggttcc gtgaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgagagcc
     151  caacagaacg ccgctttgaa cagagatttg tttcttactc tgaaagggaa
     201  gtatcctaac ttgcctgaca aggataagga cttccacata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcgt tgcaaagtga tgatgacacc
     301  acgggcataa catacactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  atgcccttcg agtctggggt aggactaacg atgcccttta tttagctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggct ggatatcatt acctatgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa ggaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc accccacgtt ga