Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMK42 coat protein gene, complete cds.

ACC No: HQ012396

Dated: 2011-01-16 | Length: 672 | CRC: -751083127

                
ID   HQ012396; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012396;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMK42 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="x Citrofortunella microcarpa"
FT                   /isolate="AMK42"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Keluang"
FT                   /collection_date="Jan-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15581.1"
FT                   /translation="MDGRTKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGMT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFTP
FT                   R"
XX
SQ   Sequence 672 BP; 196 A; 126 C; 170 G; 180 T; 0 other;

hq012396 Length: 672  16-JAN-2011  Type: N  Check: 3663  ..

       1  atggacggac gaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtatga cgtacactcg ggaaggtgtt gaagtggaat tgtctgacaa
     351  actttggaca gacgttgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggggctg
     551  gcttgactga tttagaatgt gcagtgtaca tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gtcactaatg tcaggcagct
     651  tgggaaattc accccccgtt ga