Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AMM11 coat protein gene, complete cds.

ACC No: HQ012398

Dated: 2011-01-16 | Length: 672 | CRC: -869746394

                
ID   HQ012398; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   HQ012398;
XX
DT   16-JAN-2011 (Rel. 107, Created)
DT   16-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AMM11 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Ayazpour K., Sijam K., Vadamalai G., Jaafar H.;
RT   ;
RL   Submitted (03-AUG-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Faculty of Agriculture, University Putra
RL   Malaysia, Upm Darul Ehsan, Serdang, Selangor 43400, Malaysia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata"
FT                   /isolate="AMM11"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia:Marang"
FT                   /collection_date="Feb-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADV15583.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGMT
FT                   YTREGVEVELSDKLWTDVVYNSKGIGKRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVIVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 203 A; 124 C; 166 G; 179 T; 0 other;

hq012398 Length: 672  16-JAN-2011  Type: N  Check: 851  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgagtacc
     151  caacagaatg ctgctttgaa cagagatttg tttcttactt tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggcatga cgtacactcg ggagggtgtt gaagtggaat tgtctgacaa
     351  actttggacc gacgtcgtgt ataattctaa gggtattggt aaacgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagacgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagccg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaagtcata gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga